lpqG Family assigned · medium auto-curated

H37Rv Rv3623 · MTBC0 mtbc0_003840 · 240 aa · 4086231–4086953 MTBC0 (+) · RefSeq NP_218140.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand ftsH (Rv3610c) — requalified: ATP-dependent zinc metalloprotease FtsH ftsH Rv3612c (Rv3612c) — dark: hypothetical protein Rv3613c (Rv3613c) — family_assigned: hypothetical protein espD (Rv3614c) — requalified: type VII secretion system ESX-1 target EspD espC (Rv3615c) — requalified: type VII secretion system ESX-1 filament-forming target EspC espA (Rv3616c) — requalified: type VII secretion system ESX-1 target EspA espA ephA (Rv3617) — requalified: epoxide hydrolase EphA ephA Rv3618 (Rv3618) — requalified: LLM class flavin-dependent oxidoreductase Rv3618 esxI (Rv1037c) — requalified: type VII secretion system ESX-5 protein EsxL esxW (Rv3620c) — requalified: type VII secretion system protein EsxW lpqG (Rv3623) — family_assigned: SIMPL domain-containing protein hpt (Rv3624c) — requalified: hypoxanthine phosphoribosyltransferase mesJ (Rv3625c) — requalified: tRNA lysidine(34) synthetase TilS mesJ Rv3626c (Rv3626c) — requalified: zinc-dependent metalloprotease Rv3626c dacB (Rv3627c) — requalified: D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endop dacB ppa (Rv3628) — requalified: inorganic diphosphatase Rv3629c (Rv3629c) — family_assigned: DUF475 domain-containing protein Rv3629c Rv3630 (Rv3630) — family_assigned: hypothetical protein Rv3630 Rv3631 (Rv3631) — family_assigned: glycosyltransferase family 2 protein Rv3632 (Rv3632) — family_assigned: DUF2304 domain-containing protein Rv3633 (Rv3633) — family_assigned: phytanoyl-CoA dioxygenase family protein Rv3633 galE1 (Rv3634c) — requalified: UDP-glucose 4-epimerase galE1 Rv3635 (Rv3635) — family_assigned: hypothetical protein Rv3635 4 076 kb 4 080 kb 4 084 kb 4 088 kb 4 092 kb 4 096 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqG
MTBC0 PGAP re-annotationSIMPL domain-containing protein
Revised (this work)SIMPL domain-containing protein. Pfam: SIMPL (PF04402.20).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
Mycobacterium tuberculosis H37Rv LpqG Protein Peptides Can Inhibit Mycobacterial Entry through Specific Interactions. doi:10.3390/molecules23030526 2018
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. doi:10.1186/1471-2180-10-132 2010

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder22% of residues (metapredict) · mean AlphaFold pLDDT 85.3
Disordered regions2 IDR(s), longest 38 aa [0-35, 202-240]

carries a substantial disordered region (73/240 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index -0.23 (95% CI -0.35 to -0.11). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3647 · 100.0% identity
M. marinum MMAR_5123 · 71.3% identity
M. smegmatis MSMEG_6109 · 62.9% identity
M. abscessus MAB_0525c · 47.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6X7X3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved lipoprotein LpqG

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelpqG
eggNOG descriptionProtein of unknown function (DUF541)
Orthologous groupCOG2968
KEGG orthology K09807

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.489 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 73.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 41.0%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD8 29% L6, L9, Microti, Orygis, Bovis, La4, Caprae

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 110.833333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance431.0 ppm · rank 466/3519 (86.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) lipoprotein

Predictionpredicted lipoprotein (lipobox + signal peptide)
DeepTMHMM classSP
Lipoboxsignal-peptidase-II lipobox; lipidated Cys near position 23

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length240 aa
Molecular weight24.8 kDa
Theoretical pI5.52
GRAVY-0.055 (hydrophilic)
Aliphatic index93.5
Aromaticity0.033
Instability index21.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SIMPLPF04402.20 7.4e-4938–237 Protein of unknown function (DUF541)

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.3

PDB hitprobTM-scoreE-valueDescription
4hvz-assembly1_B 1.00 0.81 3.4e-16 sig 4hvz-assembly1_B Crystal structure of brucella abortus immunogenic BP26 protein
7c51-assembly1_A 1.00 0.61 6.6e-11 sig 7c51-assembly1_A Crystal structure of a Simpl-like protein from Campylobacter jejuni (native protein)
8pk0-assembly1_f 1.00 0.55 1.7e-04 sig 8pk0-assembly1_f human mitoribosomal large subunit assembly intermediate 1 with GTPBP10-GTPBP7
8oiq-assembly1_Bw 1.00 0.44 1.6e-04 sig 8oiq-assembly1_Bw 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA
8any-assembly1_f 1.00 0.46 7.4e-04 sig 8any-assembly1_f Human mitochondrial ribosome in complex with LRPPRC, SLIRP, A-site, P-site, E-site tRNAs and mRNA

Foldseek search of the AlphaFold DB model (mean pLDDT 85.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)PE32 (- strand, 328 bp gap)
Downstream (3' on genome)hpt (- strand, 4 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: pheT (phenylalanine--tRNA ligase subunit beta), medium confidence from genomic context alone (score 505 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 504 505 ctx neighborhood:500
Rv0995 rimJ ribosomal-protein-alanine acetyltransferase RimJ 411 411
Rv3422c tsaE tRNA threonylcarbamoyladenosine biosynthesis protein 410 411 ctx cooccurence:409
Rv3619c esxV ESAT-6 like protein EsxV 504 291
Rv3629c integral membrane protein 512 167 textmining:439
Rv1539 lspA lipoprotein signal peptidase 521 112 textmining:483
Rv3759c proX glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX 481 112 textmining:440
Rv1252c lprE lipoprotein LprE 419 87
Rv2585c lipoprotein 716 76 textmining:705
Rv1899c lppD lipoprotein LppD 529 75 textmining:512
Rv3859c gltB glutamate synthase large subunit 443 70 textmining:426
Rv0411c glnH glutamine-binding lipoprotein GlnH 422 64 textmining:408
Rv2563 glutamine ABC transporter permease 520 59 textmining:511
Rv3390 lpqD lipoprotein LpqD 581 54 textmining:575
Rv0483 lprQ lipoprotein LprQ 456 52 textmining:450

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqG
  • MTBC0 PGAP product: SIMPL domain-containing protein
  • Pfam (hmmscan --cut_ga): SIMPL PF04402.20 (E=7e-49)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218140.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SIMPL (PF04402.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2968
  • Curated reference: UniProt I6X7X3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor pheT
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003840|Rv3623|lpqG
MIRLVRHSIALVAAGLAAALSGCDSHNSGSLGADPRQVTVFGSGQVQGVPDTLIADVGIQVTAADVTSAMNQTNDRQQAVIDALVGAGLDRKDIRTTRVTVAPQYSNPEPAGTATITGYRADNDIEVKIHPTDAASRLLALVVSTGGDATRISSVSYSIGDDSQLVKDARARAFQDAKNRADQYAQLSGLRLGKVISISEASGAAPTHEAPAPPRGLSAVPLEPGQQTVGFSVTVVWELT