lpqG Family assigned · medium auto-curated

H37Rv Rv3623 · MTBC0 mtbc0_003840 · 240 aa · 4086231–4086953 (+) · RefSeq NP_218140.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqG
MTBC0 PGAP re-annotationSIMPL domain-containing protein
Revised (this work)SIMPL domain-containing protein. Pfam: SIMPL (PF04402.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X7X3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved lipoprotein LpqG

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelpqG
eggNOG descriptionProtein of unknown function (DUF541)
Orthologous groupCOG2968
KEGG orthology K09807

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.489 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SIMPLPF04402.20 7.4e-4938–237 Protein of unknown function (DUF541)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pheT (phenylalanine--tRNA ligase subunit beta), medium confidence from genomic context alone (score 505 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 504 505 ctx neighborhood:500
Rv0995 rimJ ribosomal-protein-alanine acetyltransferase RimJ 411 411
Rv3422c tsaE tRNA threonylcarbamoyladenosine biosynthesis protein 410 411 ctx cooccurence:409
Rv3619c esxV ESAT-6 like protein EsxV 504 291
Rv3629c integral membrane protein 512 167 textmining:439
Rv1539 lspA lipoprotein signal peptidase 521 112 textmining:483
Rv3759c proX glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX 481 112 textmining:440
Rv1252c lprE lipoprotein LprE 419 87
Rv2585c lipoprotein 716 76 textmining:705
Rv1899c lppD lipoprotein LppD 529 75 textmining:512
Rv3859c gltB glutamate synthase large subunit 443 70 textmining:426
Rv0411c glnH glutamine-binding lipoprotein GlnH 422 64 textmining:408
Rv2563 glutamine ABC transporter permease 520 59 textmining:511
Rv3390 lpqD lipoprotein LpqD 581 54 textmining:575
Rv0483 lprQ lipoprotein LprQ 456 52 textmining:450

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqG
  • MTBC0 PGAP product: SIMPL domain-containing protein
  • Pfam (hmmscan --cut_ga): SIMPL PF04402.20 (E=7e-49)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218140.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SIMPL (PF04402.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2968
  • Curated reference: UniProt I6X7X3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor pheT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003840|Rv3623|lpqG
MIRLVRHSIALVAAGLAAALSGCDSHNSGSLGADPRQVTVFGSGQVQGVPDTLIADVGIQVTAADVTSAMNQTNDRQQAVIDALVGAGLDRKDIRTTRVTVAPQYSNPEPAGTATITGYRADNDIEVKIHPTDAASRLLALVVSTGGDATRISSVSYSIGDDSQLVKDARARAFQDAKNRADQYAQLSGLRLGKVISISEASGAAPTHEAPAPPRGLSAVPLEPGQQTVGFSVTVVWELT