ppa Resolved · high auto-curated
H37Rv Rv3628 · MTBC0 mtbc0_003845 ·
162 aa ·
4091127–4091615 MTBC0
(+) ·
RefSeq NP_218145.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | inorganic pyrophosphatase |
|---|---|
| MTBC0 PGAP re-annotation | inorganic diphosphatase |
| Revised (this work) | Inorganic diphosphatase. Pfam: Pyrophosphatase (PF00719.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 60 publications
60 TB publications mention this gene. 60 publication(s) discuss this gene (47 in a M. tuberculosis context, 1 in other mycobacteria — M. leprae (1)).
| Publication | Date |
|---|---|
| Nucleosome-targeted host DNA depletion enables automated plasma metagenomic sequencing for sensitive detection of bloodstream pathogens. doi:10.1186/s12967-026-08597-x | 2026 |
| Single Isothermal Assay for Multi-Site Mutation Detection of Rifampicin Resistance in Mycobacterium tuberculosis. doi:10.3390/pathogens15020187 | 2026 |
| Accuracy of VIDASⓇ TB-IGRA in TB patients and individuals with different thresholds of exposure. doi:10.1016/j.ijid.2025.108318 | 2026 |
| Short Chain Fatty Acids Lower Inflammation and Restore Intestinal Integrity and Function Markers in Mycobacterium paratuberculosis-Infection In Vitro Model. doi:10.3390/nu17233663 | 2025 |
| Development of the novel Pictor PictVet™ Mycoplasma bovis IgG multiplex ELISA for the detection of Mycoplasma bovis infections in cattle. doi:10.3389/fvets.2025.1664919 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -6.24 (95% CI -6.74 to -5.77). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the function of cellular bioenergetics [catalytic activity: pyrophosphate + H(2)O = 2 orthophosphate]. |
|---|---|
| Mycobrowser EC |
3.6.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3652
· 99.4% identity |
|---|---|
| M. leprae |
ML0210c
· 90.1% identity |
| M. marinum |
MMAR_5128
· 88.9% identity |
| M. smegmatis |
MSMEG_6114
· 80.2% identity |
| M. orygis |
RJtmp_003728
· 99.4% identity |
| M. abscessus |
MAB_0518c
· 84.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WI55
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Inorganic pyrophosphatase |
| EC (curated) |
EC 3.6.1.1
|
| Curated function | Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions..; FUNCTION: Antigen that activates dendritic cells (DCs), increasing their expression of cell surface molecules and augmenting their production of TNF, IL-1beta, IL-6, IL-23 and IL-12p70. Rv3628 mediates these effects by binding to TLR2 and activating downstream MyD88-, MAPK- and NF-kappaB-dependent signaling pathways. Rv3628-stimulated DCs induce the expansion of OVA-specific CD4+ and CD8+ T cells which secrete IFN-gamma and IL-2, and the generation of effector/memory T cells. Thus, Rv3628 polarizes DCs towa. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | ppa |
| eggNOG description | Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions |
| Orthologous group | COG0221 |
| EC number |
EC 3.6.1.1
|
| KEGG orthology |
K01507
|
| KEGG pathways |
map00190
|
| Gene Ontology (29) |
GO:0000287, GO:0003674, GO:0003824, GO:0004427, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006793 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · quasi-invariant (1 sites), pN/pS sous-puissant |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 67.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) |
10 in the ORF —
9 in the essential state,
0 growth-defect,
1 non-essential,
0 growth-advantage.
Saturation 0.100,
mean read count 98.
A region of the protein devoid of TA sites is invisible to this assay: nothing can be
inferred about it, in either direction.
All 10 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1765.0 ppm · rank 108/3519 (97.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 162 aa |
|---|---|
| Molecular weight | 18.3 kDa |
| Theoretical pI | 4.73 |
| GRAVY | -0.403 (hydrophilic) |
| Aliphatic index | 78.8 |
| Aromaticity | 0.105 |
| Instability index | 29.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pyrophosphatase | PF00719.25 | 1.9e-59 | 5–158 | Inorganic pyrophosphatase |
Experimental structures (Protein Data Bank) 10 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1sxv |
X-ray diffraction | 1.3 Å | 100% |
1wcf |
X-ray diffraction | 1.54 Å | 100% |
4z71 |
X-ray diffraction | 1.85 Å | 100% |
4z70 |
X-ray diffraction | 1.95 Å | 100% |
4z72 |
X-ray diffraction | 2.352 Å | 100% |
5kdf |
X-ray diffraction | 2.45 Å | 100% |
4z74 |
X-ray diffraction | 2.55 Å | 100% |
5kde |
X-ray diffraction | 2.65 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (10 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4z71-assembly1_B |
1.00 | 0.99 | 8.8e-32 sig | 4z71-assembly1_B Crystal structure of inorganic pyrophosphatase from Mycobacterium tuberculosis in complex with Mg ions |
2uxs-assembly1_A |
1.00 | 0.99 | 8.1e-31 sig | 2uxs-assembly1_A 2.7A crystal structure of inorganic pyrophosphatase (Rv3628) from Mycobacterium tuberculosis at pH 7.5 |
4ecp-assembly1_B |
1.00 | 0.99 | 4.9e-30 sig | 4ecp-assembly1_B X-ray crystal structure of Inorganic Pyrophosphate PPA from Mycobacterium leprae |
6n1c-assembly1_F |
1.00 | 0.95 | 6.6e-20 sig | 6n1c-assembly1_F Crystal structure of Inorganic pyrophosphatase from Legionella pneumophila Philadelphia 1 |
1qez-assembly1_F |
1.00 | 0.95 | 9.9e-20 sig | 1qez-assembly1_F SULFOLOBUS ACIDOCALDARIUS INORGANIC PYROPHOSPHATASE: AN ARCHAEL PYROPHOSPHATASE. |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) active site conserved
| M-CSA entry | 916 · EC 3.6.1.1 |
|---|---|
| Catalytic residues | 6/6 identical (6/6 aligned) |
| Verdict | ACTIVE-SITE CONSERVED (6/6 catalytic residues identical) -> likely active enzyme |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3627c (- strand, 137 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3629c (- strand, 45 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hpt (hypoxanthine-guanine phosphoribosyltransferase), high confidence from genomic context alone (score 801 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1307 atpH exp |
ATP synthase subunit b/delta | 991 | 987 | coexpression:874 database:900 |
Rv1306 atpF exp |
ATP synthase subunit B | 950 | 945 | coexpression:472 database:900 |
Rv1305 atpE exp |
ATP synthase subunit C | 953 | 940 | coexpression:417 database:900 |
Rv1309 atpG exp |
ATP synthase subunit gamma | 947 | 940 | coexpression:414 database:900 |
Rv1308 atpA exp |
ATP synthase subunit alpha | 950 | 935 | database:900 |
Rv1310 atpD exp |
ATP synthase subunit beta | 939 | 930 | database:900 |
Rv1311 atpC exp |
ATP synthase subunit epsilon | 924 | 925 | database:900 |
Rv1304 atpB exp |
ATP synthase subunit A | 928 | 918 | database:900 |
Rv3232c ppk2 exp |
polyphosphate kinase | 934 | 904 | database:900 |
Rv2984 ppk1 exp |
polyphosphate kinase | 944 | 900 | database:900 textmining:462 |
Rv2357c glyS |
glycine--tRNA ligase | 836 | 821 | coexpression:811 |
Rv3624c hpt |
hypoxanthine-guanine phosphoribosyltransferase | 801 | 801 ctx | neighborhood:774 |
Rv3443c rplM |
50S ribosomal protein L13 | 797 | 798 | coexpression:765 |
Rv2299c htpG |
chaperone protein HtpG | 788 | 776 | coexpression:752 |
Rv3626c hyp |
hypothetical protein | 775 | 775 ctx | neighborhood:774 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: inorganic pyrophosphatase
- MTBC0 PGAP product: inorganic diphosphatase
- Pfam (hmmscan --cut_ga): Pyrophosphatase PF00719.25 (E=2e-59)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218145.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pyrophosphatase (PF00719.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0221 - Curated reference: UniProt P9WI55 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.5)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 916; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
127 functional partner(s); context anchor
hpt - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003845|Rv3628|ppa MQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALVLLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIKHFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKAGTH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ppa? Email the maintainer — the message is pre-filled with this gene's details.