ppa Resolved · high auto-curated

H37Rv Rv3628 · MTBC0 mtbc0_003845 · 162 aa · 4091127–4091615 (+) · RefSeq NP_218145.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)inorganic pyrophosphatase
MTBC0 PGAP re-annotationinorganic diphosphatase
Revised (this work)Inorganic diphosphatase. Pfam: Pyrophosphatase (PF00719.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WI55 SwissProt · reviewed · Evidence at protein level
UniProt nameInorganic pyrophosphatase
EC (curated) EC 3.6.1.1
Curated functionCatalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions..; FUNCTION: Antigen that activates dendritic cells (DCs), increasing their expression of cell surface molecules and augmenting their production of TNF, IL-1beta, IL-6, IL-23 and IL-12p70. Rv3628 mediates these effects by binding to TLR2 and activating downstream MyD88-, MAPK- and NF-kappaB-dependent signaling pathways. Rv3628-stimulated DCs induce the expansion of OVA-specific CD4+ and CD8+ T cells which secrete IFN-gamma and IL-2, and the generation of effector/memory T cells. Thus, Rv3628 polarizes DCs towa.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameppa
eggNOG descriptionCatalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions
Orthologous groupCOG0221
EC number EC 3.6.1.1
KEGG orthology K01507
KEGG pathways map00190
Gene Ontology (29) GO:0000287, GO:0003674, GO:0003824, GO:0004427, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006793 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PyrophosphatasePF00719.25 1.9e-595–158 Inorganic pyrophosphatase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hpt (hypoxanthine-guanine phosphoribosyltransferase), high confidence from genomic context alone (score 801 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1307 atpH ATP synthase subunit b/delta 991 987 coexpression:874 database:900
Rv1306 atpF ATP synthase subunit B 950 945 coexpression:472 database:900
Rv1305 atpE ATP synthase subunit C 953 940 coexpression:417 database:900
Rv1309 atpG ATP synthase subunit gamma 947 940 coexpression:414 database:900
Rv1308 atpA ATP synthase subunit alpha 950 935 database:900
Rv1310 atpD ATP synthase subunit beta 939 930 database:900
Rv1311 atpC ATP synthase subunit epsilon 924 925 database:900
Rv1304 atpB ATP synthase subunit A 928 918 database:900
Rv3232c ppk2 polyphosphate kinase 934 904 database:900
Rv2984 ppk1 polyphosphate kinase 944 900 database:900 textmining:462
Rv2357c glyS glycine--tRNA ligase 836 821 coexpression:811
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 801 801 ctx neighborhood:774
Rv3443c rplM 50S ribosomal protein L13 797 798 coexpression:765
Rv2299c htpG chaperone protein HtpG 788 776 coexpression:752
Rv3626c hyp hypothetical protein 775 775 ctx neighborhood:774

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: inorganic pyrophosphatase
  • MTBC0 PGAP product: inorganic diphosphatase
  • Pfam (hmmscan --cut_ga): Pyrophosphatase PF00719.25 (E=2e-59)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218145.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pyrophosphatase (PF00719.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0221
  • Curated reference: UniProt P9WI55 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 127 functional partner(s); context anchor hpt
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003845|Rv3628|ppa
MQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALVLLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIKHFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKAGTH