ppa Resolved · high auto-curated

H37Rv Rv3628 · MTBC0 mtbc0_003845 · 162 aa · 4091127–4091615 MTBC0 (+) · RefSeq NP_218145.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand espA (Rv3616c) — requalified: type VII secretion system ESX-1 target EspA ephA (Rv3617) — requalified: epoxide hydrolase EphA ephA Rv3618 (Rv3618) — requalified: LLM class flavin-dependent oxidoreductase Rv3618 esxI (Rv1037c) — requalified: type VII secretion system ESX-5 protein EsxL esxW (Rv3620c) — requalified: type VII secretion system protein EsxW lpqG (Rv3623) — family_assigned: SIMPL domain-containing protein hpt (Rv3624c) — requalified: hypoxanthine phosphoribosyltransferase mesJ (Rv3625c) — requalified: tRNA lysidine(34) synthetase TilS mesJ Rv3626c (Rv3626c) — requalified: zinc-dependent metalloprotease Rv3626c dacB (Rv3627c) — requalified: D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endop dacB ppa (Rv3628) — requalified: inorganic diphosphatase Rv3629c (Rv3629c) — family_assigned: DUF475 domain-containing protein Rv3629c Rv3630 (Rv3630) — family_assigned: hypothetical protein Rv3630 Rv3631 (Rv3631) — family_assigned: glycosyltransferase family 2 protein Rv3632 (Rv3632) — family_assigned: DUF2304 domain-containing protein Rv3633 (Rv3633) — family_assigned: phytanoyl-CoA dioxygenase family protein Rv3633 galE1 (Rv3634c) — requalified: UDP-glucose 4-epimerase galE1 Rv3635 (Rv3635) — family_assigned: hypothetical protein Rv3635 Rv3638 (Rv3638) — family_assigned: ATP-binding protein Rv3640c (Rv3640c) — family_assigned: IS256-like element IS1553 family transposase Rv3640c 4 080 kb 4 084 kb 4 088 kb 4 092 kb 4 096 kb 4 100 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)inorganic pyrophosphatase
MTBC0 PGAP re-annotationinorganic diphosphatase
Revised (this work)Inorganic diphosphatase. Pfam: Pyrophosphatase (PF00719.25).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 60 publications

60 TB publications mention this gene. 60 publication(s) discuss this gene (47 in a M. tuberculosis context, 1 in other mycobacteria — M. leprae (1)).

Most recent 5 of 60.
PublicationDate
Nucleosome-targeted host DNA depletion enables automated plasma metagenomic sequencing for sensitive detection of bloodstream pathogens. doi:10.1186/s12967-026-08597-x 2026
Single Isothermal Assay for Multi-Site Mutation Detection of Rifampicin Resistance in Mycobacterium tuberculosis. doi:10.3390/pathogens15020187 2026
Accuracy of VIDASⓇ TB-IGRA in TB patients and individuals with different thresholds of exposure. doi:10.1016/j.ijid.2025.108318 2026
Short Chain Fatty Acids Lower Inflammation and Restore Intestinal Integrity and Function Markers in Mycobacterium paratuberculosis-Infection In Vitro Model. doi:10.3390/nu17233663 2025
Development of the novel Pictor PictVet™ Mycoplasma bovis IgG multiplex ELISA for the detection of Mycoplasma bovis infections in cattle. doi:10.3389/fvets.2025.1664919 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -6.24 (95% CI -6.74 to -5.77). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in the function of cellular bioenergetics [catalytic activity: pyrophosphate + H(2)O = 2 orthophosphate].
Mycobrowser EC 3.6.1.1 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3652 · 99.4% identity
M. leprae ML0210c · 90.1% identity
M. marinum MMAR_5128 · 88.9% identity
M. smegmatis MSMEG_6114 · 80.2% identity
M. orygis RJtmp_003728 · 99.4% identity
M. abscessus MAB_0518c · 84.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WI55 SwissProt · reviewed · Evidence at protein level
UniProt nameInorganic pyrophosphatase
EC (curated) EC 3.6.1.1
Curated functionCatalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions..; FUNCTION: Antigen that activates dendritic cells (DCs), increasing their expression of cell surface molecules and augmenting their production of TNF, IL-1beta, IL-6, IL-23 and IL-12p70. Rv3628 mediates these effects by binding to TLR2 and activating downstream MyD88-, MAPK- and NF-kappaB-dependent signaling pathways. Rv3628-stimulated DCs induce the expansion of OVA-specific CD4+ and CD8+ T cells which secrete IFN-gamma and IL-2, and the generation of effector/memory T cells. Thus, Rv3628 polarizes DCs towa.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameppa
eggNOG descriptionCatalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions
Orthologous groupCOG0221
EC number EC 3.6.1.1
KEGG orthology K01507
KEGG pathways map00190
Gene Ontology (29) GO:0000287, GO:0003674, GO:0003824, GO:0004427, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006793 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · quasi-invariant (1 sites), pN/pS sous-puissant
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 86.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 67.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 10 in the ORF — 9 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.100, mean read count 98. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
All 10 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1765.0 ppm · rank 108/3519 (97.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length162 aa
Molecular weight18.3 kDa
Theoretical pI4.73
GRAVY-0.403 (hydrophilic)
Aliphatic index78.8
Aromaticity0.105
Instability index29.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PyrophosphatasePF00719.25 1.9e-595–158 Inorganic pyrophosphatase

Experimental structures (Protein Data Bank) 10 solved

PDBMethodResolutionCoverage
1sxv X-ray diffraction 1.3 Å 100%
1wcf X-ray diffraction 1.54 Å 100%
4z71 X-ray diffraction 1.85 Å 100%
4z70 X-ray diffraction 1.95 Å 100%
4z72 X-ray diffraction 2.352 Å 100%
5kdf X-ray diffraction 2.45 Å 100%
4z74 X-ray diffraction 2.55 Å 100%
5kde X-ray diffraction 2.65 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (10 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.5

PDB hitprobTM-scoreE-valueDescription
4z71-assembly1_B 1.00 0.99 8.8e-32 sig 4z71-assembly1_B Crystal structure of inorganic pyrophosphatase from Mycobacterium tuberculosis in complex with Mg ions
2uxs-assembly1_A 1.00 0.99 8.1e-31 sig 2uxs-assembly1_A 2.7A crystal structure of inorganic pyrophosphatase (Rv3628) from Mycobacterium tuberculosis at pH 7.5
4ecp-assembly1_B 1.00 0.99 4.9e-30 sig 4ecp-assembly1_B X-ray crystal structure of Inorganic Pyrophosphate PPA from Mycobacterium leprae
6n1c-assembly1_F 1.00 0.95 6.6e-20 sig 6n1c-assembly1_F Crystal structure of Inorganic pyrophosphatase from Legionella pneumophila Philadelphia 1
1qez-assembly1_F 1.00 0.95 9.9e-20 sig 1qez-assembly1_F SULFOLOBUS ACIDOCALDARIUS INORGANIC PYROPHOSPHATASE: AN ARCHAEL PYROPHOSPHATASE.

Foldseek search of the AlphaFold DB model (mean pLDDT 96.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry916 · EC 3.6.1.1
Catalytic residues6/6 identical (6/6 aligned)
VerdictACTIVE-SITE CONSERVED (6/6 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv3627c (- strand, 137 bp gap)
Downstream (3' on genome)Rv3629c (- strand, 45 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: hpt (hypoxanthine-guanine phosphoribosyltransferase), high confidence from genomic context alone (score 801 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1307 atpH exp ATP synthase subunit b/delta 991 987 coexpression:874 database:900
Rv1306 atpF exp ATP synthase subunit B 950 945 coexpression:472 database:900
Rv1305 atpE exp ATP synthase subunit C 953 940 coexpression:417 database:900
Rv1309 atpG exp ATP synthase subunit gamma 947 940 coexpression:414 database:900
Rv1308 atpA exp ATP synthase subunit alpha 950 935 database:900
Rv1310 atpD exp ATP synthase subunit beta 939 930 database:900
Rv1311 atpC exp ATP synthase subunit epsilon 924 925 database:900
Rv1304 atpB exp ATP synthase subunit A 928 918 database:900
Rv3232c ppk2 exp polyphosphate kinase 934 904 database:900
Rv2984 ppk1 exp polyphosphate kinase 944 900 database:900 textmining:462
Rv2357c glyS glycine--tRNA ligase 836 821 coexpression:811
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 801 801 ctx neighborhood:774
Rv3443c rplM 50S ribosomal protein L13 797 798 coexpression:765
Rv2299c htpG chaperone protein HtpG 788 776 coexpression:752
Rv3626c hyp hypothetical protein 775 775 ctx neighborhood:774

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: inorganic pyrophosphatase
  • MTBC0 PGAP product: inorganic diphosphatase
  • Pfam (hmmscan --cut_ga): Pyrophosphatase PF00719.25 (E=2e-59)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218145.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pyrophosphatase (PF00719.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0221
  • Curated reference: UniProt P9WI55 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.5)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 916; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 127 functional partner(s); context anchor hpt
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003845|Rv3628|ppa
MQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALVLLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIKHFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKAGTH