MTBC Gene Atlas

Rv3613c Family assigned · low

H37Rv Rv3613c · MTBC0 mtbc0_003830 · 53 aa · 4077585–4077746 (-) · RefSeq NP_218130.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Member of the espACD-Rv3613c-Rv3612c operon required for virulence-critical ESX-1 secretion. RefSeq leaves it of unknown function. This five-gene operon, positively regulated by EspR through a distal enhancer (the espA activating region), is essential for ESX-1 secretion and virulence (Hunt 2012). Molecular function of Rv3613c unfixed but tied to the ESX-1 secretion apparatus.

Curated reference (UniProt)

UniProt O06270 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: espD (ESX-1 secretion-associated protein EspD), high confidence from genomic context alone (score 912 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3614c espD ESX-1 secretion-associated protein EspD 912 912 ctx neighborhood:574 coexpression:802
Rv3612c hyp hypothetical protein 848 830 ctx neighborhood:700 coexpression:458
Rv3615c espC ESX-1 secretion-associated protein EspC 857 828 coexpression:732
Rv3616c espA ESX-1 secretion-associated protein EspA 843 810 coexpression:735
Rv2485c lipQ carboxylesterase LipQ 487 64 textmining:475
Rv1470 trxA thioredoxin TrxA 547 44 textmining:546
Rv0483 lprQ lipoprotein LprQ 512 44 textmining:511
Rv0188 transmembrane protein 515 41 textmining:515
Rv3839 hyp hypothetical protein 439 41 textmining:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Member of the espACD-Rv3613c-Rv3612c ESX-1 secretion operon, essential for virulence (Hunt 2012, PMID 22389481)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218130.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O06270 (TrEMBL, unreviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 47.8, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor espD
  • Primary literature: Hunt DM, Sweeney NP, Mori L, Whalan RH, Comas I, Norman L, Cortes T, Arnvig KB, Davis EO, Stapleton MR, Green J, Buxton RS (2012). Long-range transcriptional control of an operon necessary for virulence-critical ESX-1 secretion in Mycobacterium tuberculosis J Bacteriol 194(9):2307-20. doi:10.1128/JB.00142-12 PMID:22389481

Ancestral MTBC0 protein sequence

>mtbc0_003830|Rv3613c|
MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL