Rv3605c Family assigned · low

H37Rv Rv3605c · MTBC0 mtbc0_003823 · 158 aa · 4071409–4071885 (-) · RefSeq NP_218122.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3180 domain-containing protein
Revised (this work)Polytopic integral membrane protein with 4 predicted transmembrane helices (DeepTMHMM). RefSeq leaves it 'hypothetical protein'. A topological feature consistent with a membrane transporter/permease or membrane-embedded enzyme; the transported substrate and molecular function are undetermined.

Curated reference (UniProt)

UniProt O06277 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved secreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3180)
Orthologous group2DRQG

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.061 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3180PF11377.14 3.7e-389–146 Protein of unknown function (DUF3180)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 90.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8fih-assembly1_C 0.30 0.46 2.3e+00 8fih-assembly1_C Multi-state design of two-state switchable hinge proteins
8ii8-assembly1_A 0.30 0.36 1.0e+00 8ii8-assembly1_A X-ray crystal structure of pink-colored protein from Pleurotus salmoneostramineus in complex with natural chromophore
8tsh-assembly1_L 0.28 0.80 9.2e+00 8tsh-assembly1_L S. thermodepolymerans KpsMT(E151Q)-KpsE in complex with ATP
8zah-assembly2_B 0.21 0.47 4.0e+00 8zah-assembly2_B Crystal structure of the channel protein CorA from Campylobacter jejuni
5voz-assembly1_S 0.18 0.37 3.1e+00 5voz-assembly1_S Yeast V-ATPase in complex with Legionella pneumophila effector SidK (rotational state 3)
8zak-assembly2_B 0.18 0.47 5.1e+00 8zak-assembly2_B Crystal structure of the channel protein CorA from Campylobacter jejuni in complex with Ni2+
8zak-assembly1_A 0.16 0.50 6.2e+00 8zak-assembly1_A Crystal structure of the channel protein CorA from Campylobacter jejuni in complex with Ni2+
8rtd-assembly1_H 0.10 0.34 4.6e+00 8rtd-assembly1_H Stalk-Arches-IMC structure from the fully-assembled R388 type IV secretion system determined by cryo-EM.

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: folE (GTP cyclohydrolase I), high confidence from genomic context alone (score 887 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3609c folE GTP cyclohydrolase I 887 887 ctx neighborhood:881
Rv3606c folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase 882 882 ctx neighborhood:882
Rv3608c folP1 dihydropteroate synthase 882 882 ctx neighborhood:882
Rv3607c folB dihydroneopterin aldolase 882 882 ctx neighborhood:882
Rv3610c ftsH zinc metalloprotease FtsH 812 812 ctx neighborhood:812
Rv3604c transmembrane protein 780 780 ctx neighborhood:734
Rv2744c 35kd_ag hyp hypothetical protein 767 767 ctx cooccurence:767
Rv2179c 3'-5' exoribonuclease 746 746 ctx cooccurence:746
Rv2468c hyp hypothetical protein 741 741 ctx cooccurence:741
Rv0948c chorismate mutase 730 730 ctx cooccurence:730
Rv3412 hyp hypothetical protein 728 728 ctx cooccurence:728
Rv2170 GCN5-like N-acetyltransferase 722 722 ctx cooccurence:722
Rv1638A hyp hypothetical protein 714 714 ctx cooccurence:714
Rv3311 hyp hypothetical protein 699 699 ctx cooccurence:699
Rv3004 cfp6 low molecular weight protein antigen 6 696 696 ctx cooccurence:696

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • DeepTMHMM: 4 transmembrane helices (type TM)
  • Integral membrane topology (localisation feature, not a function)
  • DeepTMHMM topology prediction (project 'Still unknown gene function', phase8, 2026-06-10). A topological feature, not a demonstrated molecular function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218122.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3180 (PF11377.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRQG
  • Curated reference: UniProt O06277 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 90.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 89 functional partner(s); context anchor folE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003823|Rv3605c|
MGPTRKRDLTAAVVGAAAVGYLLVAVLYRWFPPITVWTGLSLLAVAVAEALWARYVRVKISDGEIGDGPGWLHPLVVARSLMVAKASAWVGALVTGWWIGVLAYFLPRRSWLRAAAEDTTGTVVAAGSALALVVAALWLQHCCKSPQDPTEHADGAES