folE Resolved · high auto-curated

H37Rv Rv3609c · MTBC0 mtbc0_003827 · 202 aa · 4073681–4074289 (-) · RefSeq NP_218126.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GTP cyclohydrolase I
MTBC0 PGAP re-annotationGTP cyclohydrolase I FolE
Revised (this work)GTP cyclohydrolase I FolE. Pfam: GTP_cyclohydroI (PF01227.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN57 SwissProt · reviewed · Evidence at protein level
UniProt nameGTP cyclohydrolase 1
EC (curated) EC 3.5.4.16

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namefolE
eggNOG descriptionGTP cyclohydrolase
Orthologous groupCOG0302
EC number EC 3.5.4.16
KEGG orthology K01495
KEGG pathways map00790, map01100
KEGG modules M00126, M00841, M00842, M00843
Gene Ontology (77) GO:0000166, GO:0001882, GO:0001883, GO:0003674, GO:0003824, GO:0003933, GO:0003934, GO:0005488, GO:0005525, GO:0005575, GO:0005622, GO:0005623 +65 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GTP_cyclohydroIPF01227.28 4.4e-7622–199 GTP cyclohydrolase I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: folP1 (dihydropteroate synthase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3608c folP1 dihydropteroate synthase 999 998 ctx neighborhood:881 fusion:460 cooccurence:539 coexpression:943 textmining:772
Rv3607c folB dihydroneopterin aldolase 999 998 ctx neighborhood:881 cooccurence:489 coexpression:967 textmining:862
Rv3606c folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase 998 997 ctx neighborhood:836 cooccurence:580 coexpression:957 textmining:586
Rv3610c ftsH zinc metalloprotease FtsH 976 974 ctx neighborhood:867 coexpression:816
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 964 916 database:900 textmining:593
Rv1940 ribA1 riboflavin biosynthesis protein RibA 972 908 database:900 textmining:715
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 906 907 database:900
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 906 906 database:900
Rv3605c hyp hypothetical protein 887 887 ctx neighborhood:881
Rv1207 folP2 dihydropteroate synthase 928 876 ctx cooccurence:518 coexpression:733 textmining:445
Rv2445c ndkA nucleoside diphosphate kinase 846 837 database:800
Rv1617 pykA pyruvate kinase 812 812 database:800
Rv2583c relA bifunctional (p)ppGpp synthase/hydrolase RelA 816 809 database:800
Rv3645 transmembrane protein 808 808 database:800
Rv1625c cya adenylate cyclase 802 803 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GTP cyclohydrolase I
  • MTBC0 PGAP product: GTP cyclohydrolase I FolE
  • Pfam (hmmscan --cut_ga): GTP_cyclohydroI PF01227.28 (E=4e-76)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218126.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GTP_cyclohydroI (PF01227.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0302
  • Curated reference: UniProt P9WN57 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor folP1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003827|Rv3609c|folE
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLILRK