Rv0807 Family assigned · medium auto-curated

H37Rv Rv0807 · MTBC0 mtbc0_000856 · 129 aa · 904702–905091 (+) · RefSeq NP_215322.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationsterol carrier family protein
Revised (this work)Sterol carrier family protein. Pfam: SCP_3 (PF17844.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y8U3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameBacterial SCP orthologue domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionSterol carrier protein
Orthologous groupCOG3255

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.395 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SCP_3PF17844.7 1.3e-3835–125 Bacterial SCP ortholog

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 730 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2050 rbpA RNA polymerase-binding protein RbpA 729 730 ctx cooccurence:729
Rv2413c hyp hypothetical protein 702 703 ctx cooccurence:700
Rv2708c hyp hypothetical protein 684 685 ctx cooccurence:682
Rv2206 transmembrane protein 658 658 ctx cooccurence:658
Rv0808 purF amidophosphoribosyltransferase 637 637 ctx neighborhood:632
Rv1830 HTH-type transcriptional regulator 635 635 ctx cooccurence:620
Rv2146c transmembrane protein 630 630 ctx cooccurence:629
Rv2696c hyp hypothetical protein 627 627 ctx cooccurence:625
Rv2699c hyp hypothetical protein 621 621 ctx cooccurence:621
Rv3219 whiB1 transcriptional regulator WhiB1 621 621 ctx cooccurence:621
Rv0525 hyp hypothetical protein 613 613 ctx cooccurence:609
Rv0004 hyp hypothetical protein 607 608 ctx cooccurence:604
Rv1321 nucS endonuclease NucS 596 596 ctx cooccurence:594
Rv0809 purM phosphoribosylformylglycinamidine cyclo-ligase PurM 581 581 ctx neighborhood:579
Rv1107c xseB exodeoxyribonuclease VII small subunit 569 569 ctx cooccurence:565

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: sterol carrier family protein
  • Pfam (hmmscan --cut_ga): SCP_3 PF17844.7 (E=1e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215322.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SCP_3 (PF17844.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3255
  • Curated reference: UniProt I6Y8U3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor rbpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000856|Rv0807|
MSARDRVDPAKTRQVVLALADWLRDETLPAPDTDVLAAAVRLTARTLAALAPGASVEVRIPPFAAVQCISGPRHTRGTPPNVVQTDPRTWLLVATGLSGVAQARGSGALQLSGSRAGEIEAWLPLVDLG