Rv0807 Family assigned · medium auto-curated
H37Rv Rv0807 · MTBC0 mtbc0_000856 ·
129 aa · 904702–905091 (+) ·
RefSeq NP_215322.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | sterol carrier family protein |
| Revised (this work) | Sterol carrier family protein. Pfam: SCP_3 (PF17844.7). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y8U3
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bacterial SCP orthologue domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Sterol carrier protein |
| Orthologous group | COG3255 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.395 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SCP_3 | PF17844.7 | 1.3e-38 | 35–125 | Bacterial SCP ortholog |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 730 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 729 | 730 ctx | cooccurence:729 |
Rv2413c hyp |
hypothetical protein | 702 | 703 ctx | cooccurence:700 |
Rv2708c hyp |
hypothetical protein | 684 | 685 ctx | cooccurence:682 |
Rv2206 |
transmembrane protein | 658 | 658 ctx | cooccurence:658 |
Rv0808 purF |
amidophosphoribosyltransferase | 637 | 637 ctx | neighborhood:632 |
Rv1830 |
HTH-type transcriptional regulator | 635 | 635 ctx | cooccurence:620 |
Rv2146c |
transmembrane protein | 630 | 630 ctx | cooccurence:629 |
Rv2696c hyp |
hypothetical protein | 627 | 627 ctx | cooccurence:625 |
Rv2699c hyp |
hypothetical protein | 621 | 621 ctx | cooccurence:621 |
Rv3219 whiB1 |
transcriptional regulator WhiB1 | 621 | 621 ctx | cooccurence:621 |
Rv0525 hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:609 |
Rv0004 hyp |
hypothetical protein | 607 | 608 ctx | cooccurence:604 |
Rv1321 nucS |
endonuclease NucS | 596 | 596 ctx | cooccurence:594 |
Rv0809 purM |
phosphoribosylformylglycinamidine cyclo-ligase PurM | 581 | 581 ctx | neighborhood:579 |
Rv1107c xseB |
exodeoxyribonuclease VII small subunit | 569 | 569 ctx | cooccurence:565 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: sterol carrier family protein
- Pfam (hmmscan --cut_ga): SCP_3 PF17844.7 (E=1e-38)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215322.1)
- Domains: Pfam-A via hmmscan --cut_ga — SCP_3 (PF17844.7)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3255 - Curated reference: UniProt I6Y8U3 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
rbpA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000856|Rv0807| MSARDRVDPAKTRQVVLALADWLRDETLPAPDTDVLAAAVRLTARTLAALAPGASVEVRIPPFAAVQCISGPRHTRGTPPNVVQTDPRTWLLVATGLSGVAQARGSGALQLSGSRAGEIEAWLPLVDLG