cpdA Resolved · high auto-curated

H37Rv Rv0805 · MTBC0 mtbc0_000854 · 318 aa · 901898–902854 (+) · RefSeq NP_215320.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA
MTBC0 PGAP re-annotation3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA
Revised (this work)3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA. Pfam: Metallophos (PF00149.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP65 SwissProt · reviewed · Evidence at protein level
UniProt namecAMP/cGMP dual specificity phosphodiesterase Rv0805
EC (curated) EC 3.1.4.16, EC 3.1.4.17
Curated functionCyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP. Can use 2',3'-cAMP, 2',3'-cGMP, 3',5'-cAMP, 3',5'-cGMP and 3',5'-cUMP. Hydrolysis of 2',3'-cAMP produces a mixture of 3'-AMP (major product) and 2'-AMP (minor product). In vitro, is 150-fold more active in hydrolyzing 2',3'-cAMP than 3',5'-cAMP. Can also hydrolyze the model substrates p-nitrophenyl phosphate (pNPP), bis-(p-nitrophenyl phosphate) (bis(pNPP)) and p-nitrophenyl phenylphosphonate (pNPPP). Plays an important regulatory role in modulating the intracellular concentration of cAMP, ther.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namecpdA
eggNOG descriptionHydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes
Orthologous groupCOG1409
EC number EC 3.1.4.53
KEGG orthology K03651
KEGG pathways map00230, map02025
Gene Ontology (94) GO:0003674, GO:0003824, GO:0004112, GO:0004114, GO:0004115, GO:0005488, GO:0005506, GO:0005575, GO:0005618, GO:0005623, GO:0006139, GO:0006163 +82 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.586 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MetallophosPF00149.34 2.3e-1916–210 Calcineurin-like phosphoesterase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cpsY (exopolysaccharide phosphotransferase CpsY), high confidence from genomic context alone (score 756 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2584c apt adenine phosphoribosyltransferase 912 906 database:900
Rv2202c adoK adenosine kinase 906 906 database:900
Rv3645 transmembrane protein 918 903 database:900
Rv1264 adenylyl cyclase 906 901 database:900
Rv0733 adk adenylate kinase 906 901 database:900
Rv0777 purB adenylosuccinate lyase PurB 901 901 database:900
Rv1625c cya adenylate cyclase 947 900 database:900 textmining:499
Rv1318c adenylate cyclase 925 900 database:900
Rv1320c adenylate cyclase 924 900 database:900
Rv1319c adenylate cyclase 922 900 database:900
Rv0806c cpsY exopolysaccharide phosphotransferase CpsY 764 756 ctx cooccurence:750
Rv0803 purL phosphoribosylformylglycinamidine synthase 2 676 676 ctx neighborhood:669
Rv0804 hyp hypothetical protein 804 511 ctx neighborhood:508 textmining:616
Rv0178 Mce associated membrane protein 438 414 experimental:403
Rv1362c membrane protein 436 412 experimental:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA
  • MTBC0 PGAP product: 3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA
  • Pfam (hmmscan --cut_ga): Metallophos PF00149.34 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215320.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Metallophos (PF00149.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1409
  • Curated reference: UniProt P9WP65 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor cpsY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000854|Rv0805|cpdA
MHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHPPMVLTSSAPRSPVD