cpdA Resolved · high auto-curated

H37Rv Rv0805 · MTBC0 mtbc0_000854 · 318 aa · 901898–902854 MTBC0 (+) · RefSeq NP_215320.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA
MTBC0 PGAP re-annotation3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA
Revised (this work)3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA. Pfam: Metallophos (PF00149.34).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 15 publications

15 TB publications mention this gene. 15 publication(s) discuss this gene (14 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3), M. leprae (1)).

Most recent 5 of 15.
PublicationDate
The metallophosphoesterase Rv0805 regulates carbon flux and cell envelope homeostasis during growth of mycobacteria in propionate. doi:10.1128/jb.00571-25 2026
Mycobacterium tuberculosis PhoP integrates stress response to intracellular survival by regulating cAMP level. doi:10.7554/eLife.92136 2024
Mycobacterial phosphodiesterase Rv0805 is a virulence determinant and its cyclic nucleotide hydrolytic activity is required for propionate detoxification. doi:10.1111/mmi.15030 2023
Eukaryotic-Type Ser/Thr Protein Kinase Mediated Phosphorylation of Mycobacterial Phosphodiesterase Affects its Localization to the Cell Wall. doi:10.3389/fmicb.2016.00123 2016
Ca(II) Binding Regulates and Dominates the Reactivity of a Transition-Metal-Ion-Dependent Diesterase from Mycobacterium tuberculosis. doi:10.1002/chem.201504001 2016

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 6 % of gene

NeighbourcpsY (Rv0806c, - strand)
Overlap56 bp, 6 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Post-translational modifications

1 reported modified residue(s), incl. 1 phosphosite(s): Phosphothreonine @309.

Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).

CRISPRi vulnerability

Vulnerability index 1.54 (95% CI -0.57 to 5.08). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionHydrolyzes cyclic nucleotide monophosphate to nucleotide monophosphate. Shown to hydrolyze 2',3'-cNMP and 3',5'-cNMP.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0828 · 99.7% identity
M. leprae ML2210c · 82.9% identity
M. marinum MMAR_4886 · 84.0% identity
M. orygis RJtmp_000851 · 99.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WP65 SwissProt · reviewed · Evidence at protein level
UniProt namecAMP/cGMP dual specificity phosphodiesterase Rv0805
EC (curated) EC 3.1.4.16, EC 3.1.4.17
Curated functionCyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP. Can use 2',3'-cAMP, 2',3'-cGMP, 3',5'-cAMP, 3',5'-cGMP and 3',5'-cUMP. Hydrolysis of 2',3'-cAMP produces a mixture of 3'-AMP (major product) and 2'-AMP (minor product). In vitro, is 150-fold more active in hydrolyzing 2',3'-cAMP than 3',5'-cAMP. Can also hydrolyze the model substrates p-nitrophenyl phosphate (pNPP), bis-(p-nitrophenyl phosphate) (bis(pNPP)) and p-nitrophenyl phenylphosphonate (pNPPP). Plays an important regulatory role in modulating the intracellular concentration of cAMP, ther.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namecpdA
eggNOG descriptionHydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes
Orthologous groupCOG1409
EC number EC 3.1.4.53
KEGG orthology K03651
KEGG pathways map00230, map02025
Gene Ontology (94) GO:0003674, GO:0003824, GO:0004112, GO:0004114, GO:0004115, GO:0005488, GO:0005506, GO:0005575, GO:0005618, GO:0005623, GO:0006139, GO:0006163 +82 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.586 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 26/53 (49%) · mean identity 80.7% · 4/4 closest MTBAP relatives
present in a subset of the genus (26/53 NTM; in 4 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 44.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) cholesterol-required

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 0.944, mean read count 149.058823529. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Cholesterol catabolismrequired for growth on cholesterol (Griffin 2011)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +5.150.0 disruption advantageous
fitness in mouse infection (in vivo) +4.640.0 disruption advantageous
altered fitness under acid stress in phosphate-citrate buffer (stress) -4.610.0 required
fitness in mouse infection (in vivo) +4.290.0 disruption advantageous
fitness in mouse infection (in vivo) +4.140.0 disruption advantageous
fitness in mouse infection (in vivo) +4.130.0 disruption advantageous
fitness in mouse infection (in vivo) +3.840.0 disruption advantageous
fitness in mouse infection (in vivo) +3.740.0 disruption advantageous
fitness in mouse infection (in vivo) +3.730.0 disruption advantageous
fitness in mouse infection (in vivo) +3.700.0 disruption advantageous
fitness in mouse infection (in vivo) +3.570.0 disruption advantageous
fitness in mouse infection (in vivo) +3.480.0 disruption advantageous

Conditional fitness of transposon-disruption mutants across 54 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance21.4 ppm · rank 2303/3519 (34.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length318 aa
Molecular weight34.2 kDa
Theoretical pI5.9
GRAVY-0.067 (hydrophilic)
Aliphatic index98.8
Aromaticity0.047
Instability index38.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MetallophosPF00149.34 2.3e-1916–210 Calcineurin-like phosphoesterase

Experimental structures (Protein Data Bank) 5 solved

PDBMethodResolutionCoverage
3ib7 X-ray diffraction 1.6 Å 100%
3ib8 X-ray diffraction 1.8 Å 100%
2hy1 X-ray diffraction 1.932 Å 87%
2hyp X-ray diffraction 2.05 Å 87%
2hyo X-ray diffraction 2.25 Å 87%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.4

PDB hitprobTM-scoreE-valueDescription
3ib7-assembly1_A 1.00 0.99 5.9e-55 sig 3ib7-assembly1_A Crystal structure of full length Rv0805
2hyp-assembly1_A-2 1.00 1.00 8.0e-42 sig 2hyp-assembly1_A-2 Crystal structure of Rv0805 D66A mutant
2hy1-assembly1_A-2 1.00 0.99 9.4e-42 sig 2hy1-assembly1_A-2 Crystal structure of Rv0805
2hyo-assembly1_A-2 1.00 0.99 2.9e-41 sig 2hyo-assembly1_A-2 Crystal structure of Rv0805 N97A mutant
3d03-assembly1_A 1.00 0.84 2.4e-19 sig 3d03-assembly1_A 1.9A structure of Glycerophoshphodiesterase (GpdQ) from Enterobacter aerogenes

Foldseek search of the AlphaFold DB model (mean pLDDT 93.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0804 (+ strand, 120 bp gap)
Downstream (3' on genome)cpsY (- strand, -56 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0324 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: cpsY (exopolysaccharide phosphotransferase CpsY), high confidence from genomic context alone (score 756 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2584c apt exp adenine phosphoribosyltransferase 912 906 database:900
Rv2202c adoK exp adenosine kinase 906 906 database:900
Rv3645 exp transmembrane protein 918 903 database:900
Rv1264 exp adenylyl cyclase 906 901 database:900
Rv0733 adk exp adenylate kinase 906 901 database:900
Rv0777 purB exp adenylosuccinate lyase PurB 901 901 database:900
Rv1625c cya exp adenylate cyclase 947 900 database:900 textmining:499
Rv1318c exp adenylate cyclase 925 900 database:900
Rv1320c exp adenylate cyclase 924 900 database:900
Rv1319c exp adenylate cyclase 922 900 database:900
Rv0806c cpsY exopolysaccharide phosphotransferase CpsY 764 756 ctx cooccurence:750
Rv0803 purL phosphoribosylformylglycinamidine synthase 2 676 676 ctx neighborhood:669
Rv0804 hyp hypothetical protein 804 511 ctx neighborhood:508 textmining:616
Rv0178 exp Mce associated membrane protein 438 414 experimental:403
Rv1362c exp membrane protein 436 412 experimental:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA
  • MTBC0 PGAP product: 3'%2C5'-cyclic adenosine monophosphate phosphodiesterase CpdA
  • Pfam (hmmscan --cut_ga): Metallophos PF00149.34 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215320.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Metallophos (PF00149.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1409
  • Curated reference: UniProt P9WP65 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor cpsY
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000854|Rv0805|cpdA
MHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHPPMVLTSSAPRSPVD