Rv0525 Family assigned · medium auto-curated
H37Rv Rv0525 · MTBC0 mtbc0_000553 ·
202 aa · 619680–620288 (+) ·
RefSeq NP_215039.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | histidine phosphatase family protein |
| Revised (this work) | Histidine phosphatase family protein. Pfam: His_Phos_1 (PF00300.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06391
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0525 |
UniProt still lists this protein as Uncharacterized protein Rv0525; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| eggNOG description | phosphoglycerate mutase |
| Orthologous group | COG0406 |
| Gene Ontology (8) |
GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
His_Phos_1 | PF00300.28 | 3.0e-37 | 8–191 | Histidine phosphatase superfamily (branch 1) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0526 (thioredoxin), high confidence from genomic context alone (score 993 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0526 |
thioredoxin | 992 | 993 ctx | neighborhood:865 coexpression:943 |
Rv0524 hemL |
glutamate-1-semialdehyde 2,1-aminomutase | 980 | 980 ctx | neighborhood:882 coexpression:838 |
Rv0527 ccdA |
cytochrome C-type biogenesis protein CcdA | 933 | 934 ctx | neighborhood:865 coexpression:530 |
Rv0528 |
transmembrane protein | 914 | 914 ctx | neighborhood:820 coexpression:483 |
Rv0529 ccsA |
cytochrome C-type biogenesis protein CcsA | 896 | 897 ctx | neighborhood:820 coexpression:449 |
Rv2699c hyp |
hypothetical protein | 674 | 674 ctx | cooccurence:674 |
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 641 | 641 ctx | cooccurence:641 |
Rv1830 |
HTH-type transcriptional regulator | 637 | 638 ctx | cooccurence:635 |
Rv3219 whiB1 |
transcriptional regulator WhiB1 | 629 | 629 ctx | cooccurence:627 |
Rv3260c whiB2 |
transcriptional regulator WhiB2 | 617 | 617 ctx | cooccurence:616 |
Rv0807 hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:609 |
Rv2256c hyp |
hypothetical protein | 599 | 599 ctx | cooccurence:595 |
Rv3681c whiB4 |
transcriptional regulator WhiB4 | 598 | 598 ctx | cooccurence:596 |
Rv0523c hyp |
hypothetical protein | 594 | 594 ctx | neighborhood:593 |
Rv0530 hyp |
hypothetical protein | 593 | 593 ctx | neighborhood:587 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: histidine phosphatase family protein
- Pfam (hmmscan --cut_ga): His_Phos_1 PF00300.28 (E=3e-37)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215039.1)
- Domains: Pfam-A via hmmscan --cut_ga — His_Phos_1 (PF00300.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0406 - Curated reference: UniProt O06391 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
48 functional partner(s); context anchor
Rv0526 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000553|Rv0525| MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADALADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRDPRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLTGKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL