Rv0525 Family assigned · medium auto-curated

H37Rv Rv0525 · MTBC0 mtbc0_000553 · 202 aa · 619680–620288 (+) · RefSeq NP_215039.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhistidine phosphatase family protein
Revised (this work)Histidine phosphatase family protein. Pfam: His_Phos_1 (PF00300.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06391 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0525

UniProt still lists this protein as Uncharacterized protein Rv0525; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
eggNOG descriptionphosphoglycerate mutase
Orthologous groupCOG0406
Gene Ontology (8) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
His_Phos_1PF00300.28 3.0e-378–191 Histidine phosphatase superfamily (branch 1)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0526 (thioredoxin), high confidence from genomic context alone (score 993 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0526 thioredoxin 992 993 ctx neighborhood:865 coexpression:943
Rv0524 hemL glutamate-1-semialdehyde 2,1-aminomutase 980 980 ctx neighborhood:882 coexpression:838
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 933 934 ctx neighborhood:865 coexpression:530
Rv0528 transmembrane protein 914 914 ctx neighborhood:820 coexpression:483
Rv0529 ccsA cytochrome C-type biogenesis protein CcsA 896 897 ctx neighborhood:820 coexpression:449
Rv2699c hyp hypothetical protein 674 674 ctx cooccurence:674
Rv2050 rbpA RNA polymerase-binding protein RbpA 641 641 ctx cooccurence:641
Rv1830 HTH-type transcriptional regulator 637 638 ctx cooccurence:635
Rv3219 whiB1 transcriptional regulator WhiB1 629 629 ctx cooccurence:627
Rv3260c whiB2 transcriptional regulator WhiB2 617 617 ctx cooccurence:616
Rv0807 hyp hypothetical protein 613 613 ctx cooccurence:609
Rv2256c hyp hypothetical protein 599 599 ctx cooccurence:595
Rv3681c whiB4 transcriptional regulator WhiB4 598 598 ctx cooccurence:596
Rv0523c hyp hypothetical protein 594 594 ctx neighborhood:593
Rv0530 hyp hypothetical protein 593 593 ctx neighborhood:587

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: histidine phosphatase family protein
  • Pfam (hmmscan --cut_ga): His_Phos_1 PF00300.28 (E=3e-37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215039.1)
  • Domains: Pfam-A via hmmscan --cut_ga — His_Phos_1 (PF00300.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0406
  • Curated reference: UniProt O06391 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor Rv0526
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000553|Rv0525|
MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADALADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRDPRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLTGKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL