Rv0801 Family assigned · medium auto-curated
H37Rv Rv0801 · MTBC0 mtbc0_000850 ·
115 aa · 897698–898045 (+) ·
RefSeq NP_215316.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | VOC family protein |
| Revised (this work) | VOC family protein. Pfam: Glyoxalase_6 (PF18029.8), Glyoxalase (PF00903.32). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06633
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| eggNOG description | glyoxalase |
| Orthologous group | COG0346 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (387) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glyoxalase_6 | PF18029.8 | 1.1e-28 | 7–112 | Glyoxalase-like domain |
Glyoxalase | PF00903.32 | 2.0e-06 | 12–112 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pepC (M18 family aminopeptidase), high confidence from genomic context alone (score 874 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0800 pepC |
M18 family aminopeptidase | 873 | 874 ctx | neighborhood:872 |
Rv0799c hyp |
hypothetical protein | 756 | 747 ctx | neighborhood:744 |
Rv0798c cfp29 hyp |
hypothetical protein | 668 | 668 ctx | neighborhood:663 |
Rv1727 hyp |
hypothetical protein | 571 | 571 ctx | cooccurence:555 |
Rv0803 purL |
phosphoribosylformylglycinamidine synthase 2 | 546 | 547 ctx | neighborhood:544 |
Rv0360c hyp |
hypothetical protein | 515 | 515 ctx | cooccurence:512 |
Rv3197A whiB7 |
transcriptional regulator WhiB7 | 513 | 513 ctx | cooccurence:513 |
Rv0339c iniR |
transcriptional regulator | 497 | 497 ctx | cooccurence:463 |
Rv0007 |
membrane protein | 495 | 496 ctx | cooccurence:489 |
Rv2560 hyp |
hypothetical protein | 488 | 489 ctx | cooccurence:485 |
Rv2164c hyp |
hypothetical protein | 460 | 460 ctx | cooccurence:453 |
Rv3732 hyp |
hypothetical protein | 456 | 457 ctx | cooccurence:450 |
Rv1267c embR |
transcriptional regulator EmbR | 441 | 441 ctx | cooccurence:441 |
Rv0443 hyp |
hypothetical protein | 427 | 428 ctx | cooccurence:407 |
Rv1082 mca |
mycothiol S-conjugate amidase | 418 | 419 ctx | cooccurence:417 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: VOC family protein
- Pfam (hmmscan --cut_ga): Glyoxalase_6 PF18029.8 (E=1e-28), Glyoxalase PF00903.32 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215316.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase_6 (PF18029.8), Glyoxalase (PF00903.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0346 - Curated reference: UniProt O06633 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
pepC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000850|Rv0801| MALKVEMVTFDCSDPAKLAGWWAEQFDGTTRELLPGEFVVVARTDGPRLGFQKVPDPAPGKNRVHLDFTTKDLDAEVLRLVAAGASEVGRHQVGESFRWVVLADPEGNAFCVAGQ