Rv0801 Family assigned · medium auto-curated

H37Rv Rv0801 · MTBC0 mtbc0_000850 · 115 aa · 897698–898045 (+) · RefSeq NP_215316.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationVOC family protein
Revised (this work)VOC family protein. Pfam: Glyoxalase_6 (PF18029.8), Glyoxalase (PF00903.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06633 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionglyoxalase
Orthologous groupCOG0346

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (387) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glyoxalase_6PF18029.8 1.1e-287–112 Glyoxalase-like domain
GlyoxalasePF00903.32 2.0e-0612–112 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pepC (M18 family aminopeptidase), high confidence from genomic context alone (score 874 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0800 pepC M18 family aminopeptidase 873 874 ctx neighborhood:872
Rv0799c hyp hypothetical protein 756 747 ctx neighborhood:744
Rv0798c cfp29 hyp hypothetical protein 668 668 ctx neighborhood:663
Rv1727 hyp hypothetical protein 571 571 ctx cooccurence:555
Rv0803 purL phosphoribosylformylglycinamidine synthase 2 546 547 ctx neighborhood:544
Rv0360c hyp hypothetical protein 515 515 ctx cooccurence:512
Rv3197A whiB7 transcriptional regulator WhiB7 513 513 ctx cooccurence:513
Rv0339c iniR transcriptional regulator 497 497 ctx cooccurence:463
Rv0007 membrane protein 495 496 ctx cooccurence:489
Rv2560 hyp hypothetical protein 488 489 ctx cooccurence:485
Rv2164c hyp hypothetical protein 460 460 ctx cooccurence:453
Rv3732 hyp hypothetical protein 456 457 ctx cooccurence:450
Rv1267c embR transcriptional regulator EmbR 441 441 ctx cooccurence:441
Rv0443 hyp hypothetical protein 427 428 ctx cooccurence:407
Rv1082 mca mycothiol S-conjugate amidase 418 419 ctx cooccurence:417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: VOC family protein
  • Pfam (hmmscan --cut_ga): Glyoxalase_6 PF18029.8 (E=1e-28), Glyoxalase PF00903.32 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215316.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase_6 (PF18029.8), Glyoxalase (PF00903.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0346
  • Curated reference: UniProt O06633 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor pepC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000850|Rv0801|
MALKVEMVTFDCSDPAKLAGWWAEQFDGTTRELLPGEFVVVARTDGPRLGFQKVPDPAPGKNRVHLDFTTKDLDAEVLRLVAAGASEVGRHQVGESFRWVVLADPEGNAFCVAGQ