whiB1 Family assigned · medium auto-curated

H37Rv Rv3219 · MTBC0 - · 84 aa · 3595713–3595967 (+) · RefSeq NP_217735.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator WhiB1
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator WhiB1. Pfam: Whib (PF02467.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WF43 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator WhiB1
Curated functionActs as a transcriptional repressor, inhibiting expression in vitro. Probably redox-responsive. The apo- but not holo-form binds to its own promoter as well as that of groEL2. Oxidized apo-form and nitrosylated holo-form also bind DNA. The apo-form has been shown to act as a protein disulfide reductase, but also not to act as a protein disulfide reductase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namewhiB
eggNOG descriptionActs as a transcriptional regulator. Probably redox- responsive. The apo- but not holo-form probably binds DNA
Orthologous group2DMIE
KEGG orthology K18955
Gene Ontology (66) GO:0000302, GO:0003674, GO:0003676, GO:0003677, GO:0003824, GO:0005488, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0008152, GO:0009889 +54 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WhibPF02467.22 5.5e-283–71 Transcription factor WhiB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1830 (HTH-type transcriptional regulator), high confidence from genomic context alone (score 775 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2703 sigA RNA polymerase sigma factor SigA 999 999 experimental:999 textmining:504
Rv2710 sigB RNA polymerase sigma factor SigB 880 823 experimental:821
Rv1830 HTH-type transcriptional regulator 775 775 ctx cooccurence:772
Rv2901c hyp hypothetical protein 773 773 ctx cooccurence:770
Rv1440 secG protein-export membrane protein SecG 771 772 ctx cooccurence:769
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 768 768 ctx cooccurence:758
Rv1321 nucS endonuclease NucS 735 736 ctx cooccurence:732
Rv3218 hyp hypothetical protein 869 722 ctx neighborhood:720 textmining:550
Rv3195 hyp hypothetical protein 701 701 ctx cooccurence:701
Rv2050 rbpA RNA polymerase-binding protein RbpA 711 677 ctx cooccurence:672
Rv1025 hyp hypothetical protein 656 656 ctx cooccurence:656
Rv3907c pcnA poly(A) polymerase PcnA 640 640 ctx cooccurence:640
Rv2699c hyp hypothetical protein 636 637 ctx cooccurence:633
Rv0525 hyp hypothetical protein 629 629 ctx cooccurence:627
Rv0807 hyp hypothetical protein 621 621 ctx cooccurence:621

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator WhiB1
  • Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=5e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217735.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DMIE
  • Curated reference: UniProt P9WF43 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 55 functional partner(s); context anchor Rv1830
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3219|whiB1
MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRALKRRNARTKARTGV