phoY2 Resolved · high auto-curated

H37Rv Rv0821c · MTBC0 mtbc0_000870 · 213 aa · 916625–917266 (-) · RefSeq NP_215336.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphate-transport system transcriptional regulator PhoY2
MTBC0 PGAP re-annotationphosphate signaling complex protein PhoU
Revised (this work)Phosphate signaling complex protein PhoU. Pfam: PhoU (PF01895.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WI95 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphate-specific transport system accessory protein PhoU homolog 2
Curated functionPlays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoP or a PhoR-PhoP complex to promote dephosphorylation of phospho-PhoP, or inhibit formation of the PhoR-PhoP transitory complex (By similarity). Important for tolerance to antibiotics.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namephoU
eggNOG descriptionPlays a role in the regulation of phosphate uptake
Orthologous groupCOG0704
KEGG orthology K02039
Gene Ontology (49) GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0008150, GO:0009892, GO:0010563, GO:0010966, GO:0019220 +37 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.316 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhoUPF01895.25 1.4e-1417–103 PhoU domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: phoT (phosphate ABC transporter ATP-binding protein PhoT), high confidence from genomic context alone (score 924 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0820 phoT phosphate ABC transporter ATP-binding protein PhoT 945 924 ctx cooccurence:769 coexpression:668
Rv0930 pstA1 phosphate ABC transporter permease PstA 956 923 ctx cooccurence:764 coexpression:668 textmining:466
Rv0936 pstA2 phosphate ABC transporter permease PstA 941 922 ctx cooccurence:761 coexpression:668
Rv0933 pstB phosphate ABC transporter ATP-binding protein PstB 966 921 ctx cooccurence:759 coexpression:668 textmining:588
Rv3197 ABC transporter ATP-binding protein 791 791 coexpression:788
Rv0935 pstC1 phosphate ABC transporter permease PstC 871 784 ctx cooccurence:752 textmining:427
Rv0929 pstC2 phosphate ABC transporter permease PstC 834 783 ctx cooccurence:751
Rv0822c hyp hypothetical protein 654 654 ctx neighborhood:649
Rv0928 pstS3 phosphate ABC transporter substrate-binding lipoprotein PstS 677 576 coexpression:417
Rv0932c pstS2 phosphate ABC transporter substrate-binding lipoprotein PstS 673 571 coexpression:418
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 663 559 coexpression:418
Rv0823c dusB tRNA-dihydrouridine synthase 473 453 ctx neighborhood:448
Rv2903c lepB signal peptidase 442 443 coexpression:425
Rv0775 hyp hypothetical protein 418 419 coexpression:419
Rv3066 DeoR family transcriptional regulator 417 418 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphate-transport system transcriptional regulator PhoY2
  • MTBC0 PGAP product: phosphate signaling complex protein PhoU
  • Pfam (hmmscan --cut_ga): PhoU PF01895.25 (E=1e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215336.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PhoU (PF01895.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0704
  • Curated reference: UniProt P9WI95 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor phoT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000870|Rv0821c|phoY2
MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEVARRVIFQATGAFP