Rv0818 Resolved · high auto-curated
H37Rv Rv0818 · MTBC0 mtbc0_000867 ·
255 aa ·
914039–914806 MTBC0
(+) ·
RefSeq NP_215333.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | response regulator transcription factor |
| Revised (this work) | Response regulator transcription factor. Pfam: GlnR_1st (PF21695.4), Trans_reg_C (PF00486.35). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (3 in a M. tuberculosis context, 2 in other mycobacteria — M. abscessus (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Functional analysis of two component signaling system in Mycobacterium tuberculosis. doi:10.1016/j.gene.2025.149868 | 2026 |
| Application of NgAgo-mediated genome editing in Mycobacterium smegmatis. doi:10.1128/jb.00214-25 | 2025 |
| GlnR activated transcription of nitrogen metabolic pathway genes facilitates biofilm formation by mycobacterium abscessus. doi:10.1016/j.ijantimicag.2023.107025 | 2024 |
| Mycobacterium tuberculosis two-component systems and implications in novel vaccines and drugs. doi:10.1615/critreveukargeneexpr.v22.i1.30 | 2012 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | mshD (Rv0819, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.31 (95% CI -3.46 to 3.35). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in transcriptional mechanism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0841
· 99.2% identity |
|---|---|
| M. marinum |
MMAR_4865
· 90.6% identity |
| M. smegmatis |
MSMEG_5784
· 78.8% identity |
| M. orygis |
RJtmp_000864
· 98.8% identity |
| M. abscessus |
MAB_0744
· 76.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53830
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Global nitrogen response regulator GlnR (Master regulator GlnR) |
| Curated function | Global transcriptional regulator that controls the expression of genes involved in nitrogen metabolism (PubMed:26077160). It regulates genes involved in nitric oxide detoxification and intracellular survival (PubMed:26077160). It functions as both an activator and repressor of transcription, and controls the expression of at least 33 genes in response to nitrogen limitation (PubMed:26077160). Acts by binding to a consensus GlnR binding site in the promoter regions of the target genes (PubMed:19332834, PubMed:26077160). Up-regulates the expression of nirBD, which encodes a nitrite reductase, under nitrogen-limiting conditions by binding to the nirB promoter region (PubMed:19332834, PubMed:26077160). It also activates expression of the nitrate reductase (narGHJI) (PubMed:26077160)... |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K TranscriptionT Signal transduction mechanisms
|
|---|---|
| Preferred name | glnR |
| eggNOG description | transcriptional |
| Orthologous group | COG0745 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.484 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.194 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 86.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 69.6% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 11 growth-advantage. Saturation 1.000, mean read count 310.272727273. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Isoniazid (drug exposure) | +5.75 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +4.37 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +4.19 | 0.043 | disruption advantageous |
| fitness in mouse infection (in vivo) | +3.30 | 0.0055 | disruption advantageous |
| fitness in mouse infection (in vivo) | +3.21 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +3.06 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.71 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.58 | 0.0053 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.53 | 0.0064 | disruption advantageous |
| altered fitness under Meropenem (drug exposure) | -2.49 | 0.012 | required |
| fitness in mouse infection (in vivo) | +2.49 | 0.0078 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.40 | 0.0068 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 35 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 233.0 ppm · rank 766/3519 (78.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 255 aa |
|---|---|
| Molecular weight | 27.6 kDa |
| Theoretical pI | 5.22 |
| GRAVY | -0.136 (hydrophilic) |
| Aliphatic index | 105.2 |
| Aromaticity | 0.047 |
| Instability index | 34.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GlnR_1st | PF21695.4 | 3.8e-43 | 3–111 | Transcription regulator GlnR, N-terminal domain |
Trans_reg_C | PF00486.35 | 1.7e-28 | 145–218 | Transcriptional regulatory protein, C terminal |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8hih |
Electron Microscopy | 3.66 Å | 100% |
4o1i |
X-ray diffraction | 2.8 Å | 46% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8hih-assembly1_O |
1.00 | 0.73 | 3.6e-34 sig | 8hih-assembly1_O Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with transcription factor GlnR |
8hih-assembly1_N |
1.00 | 0.56 | 3.0e-35 sig | 8hih-assembly1_N Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with transcription factor GlnR |
8hih-assembly1_Q |
1.00 | 0.52 | 9.9e-32 sig | 8hih-assembly1_Q Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with transcription factor GlnR |
4o1i-assembly3_E-2 |
1.00 | 0.98 | 8.0e-18 sig | 4o1i-assembly3_E-2 Crystal Structure of the regulatory domain of MtbGlnR |
4o1h-assembly1_A |
1.00 | 0.92 | 4.3e-13 sig | 4o1h-assembly1_A Crystal Structure of the regulatory domain of AmeGlnR |
Foldseek search of the AlphaFold DB model (mean pLDDT 84.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv0817c (- strand, 129 bp gap) |
|---|---|
| Downstream (3' on genome) | mshD (+ strand, -4 bp gap) |
| Predicted operon |
Rv0818 · mshD · phoT
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulon | this transcription factor regulates 15 target gene(s) |
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mshD (mycothiol acetyltransferase), high confidence from genomic context alone (score 884 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0819 mshD |
mycothiol acetyltransferase | 888 | 884 ctx | neighborhood:882 |
Rv0600c |
two component sensor kinase HK1 | 809 | 801 ctx | cooccurence:548 |
Rv1032c trcS |
two component sensor histidine kinase TrcS | 758 | 743 ctx | cooccurence:412 |
Rv0490 senX3 |
two component sensor histidine kinase SenX3 | 841 | 742 ctx | cooccurence:537 textmining:410 |
Rv3764c tcrY |
two component sensor kinase TcrY | 756 | 741 ctx | cooccurence:407 |
Rv0820 phoT |
phosphate ABC transporter ATP-binding protein PhoT | 703 | 688 ctx | neighborhood:680 |
Rv0982 mprB |
two component histidine-protein kinase/phosphatase MprB | 688 | 676 | |
Rv0902c prrB |
two component sensor histidine kinase PrrB | 684 | 666 | |
Rv0758 phoR |
two component system response sensor kinase PhoR | 758 | 658 | |
Rv0601c |
two component sensor kinase HK2 | 655 | 643 | |
Rv0817c lmeA hyp |
hypothetical protein | 623 | 624 ctx | neighborhood:624 |
Rv3245c mtrB |
two component sensory histidine kinase MtrB | 653 | 607 | |
Rv0816c thiX |
thioredoxin ThiX | 646 | 590 ctx | neighborhood:572 |
Rv3365c hyp |
hypothetical protein | 593 | 578 | |
Rv2998A |
Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens | 593 | 578 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator
- MTBC0 PGAP product: response regulator transcription factor
- Pfam (hmmscan --cut_ga): GlnR_1st PF21695.4 (E=4e-43), Trans_reg_C PF00486.35 (E=2e-28)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215333.1)
- Domains: Pfam-A via hmmscan --cut_ga — GlnR_1st (PF21695.4), Trans_reg_C (PF00486.35)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0745 - Curated reference: UniProt O53830 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
mshD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000867|Rv0818| MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLPSTGPAEIDARLRLVVGRRGDLADQESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPGRDGMQEPLVDPLRSQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0818? Email the maintainer — the message is pre-filled with this gene's details.