Rv0818 Resolved · high auto-curated

H37Rv Rv0818 · MTBC0 mtbc0_000867 · 255 aa · 914039–914806 (+) · RefSeq NP_215333.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationresponse regulator transcription factor
Revised (this work)Response regulator transcription factor. Pfam: GlnR_1st (PF21695.4), Trans_reg_C (PF00486.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53830 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTranscriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
T Signal transduction mechanisms
Preferred nameglnR
eggNOG descriptiontranscriptional
Orthologous groupCOG0745

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.484 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlnR_1stPF21695.4 3.8e-433–111 Transcription regulator GlnR, N-terminal domain
Trans_reg_CPF00486.35 1.7e-28145–218 Transcriptional regulatory protein, C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mshD (mycothiol acetyltransferase), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0819 mshD mycothiol acetyltransferase 888 884 ctx neighborhood:882
Rv0600c two component sensor kinase HK1 809 801 ctx cooccurence:548
Rv1032c trcS two component sensor histidine kinase TrcS 758 743 ctx cooccurence:412
Rv0490 senX3 two component sensor histidine kinase SenX3 841 742 ctx cooccurence:537 textmining:410
Rv3764c tcrY two component sensor kinase TcrY 756 741 ctx cooccurence:407
Rv0820 phoT phosphate ABC transporter ATP-binding protein PhoT 703 688 ctx neighborhood:680
Rv0982 mprB two component histidine-protein kinase/phosphatase MprB 688 676
Rv0902c prrB two component sensor histidine kinase PrrB 684 666
Rv0758 phoR two component system response sensor kinase PhoR 758 658
Rv0601c two component sensor kinase HK2 655 643
Rv0817c lmeA hyp hypothetical protein 623 624 ctx neighborhood:624
Rv3245c mtrB two component sensory histidine kinase MtrB 653 607
Rv0816c thiX thioredoxin ThiX 646 590 ctx neighborhood:572
Rv3365c hyp hypothetical protein 593 578
Rv2998A Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens 593 578

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: response regulator transcription factor
  • Pfam (hmmscan --cut_ga): GlnR_1st PF21695.4 (E=4e-43), Trans_reg_C PF00486.35 (E=2e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215333.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GlnR_1st (PF21695.4), Trans_reg_C (PF00486.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0745
  • Curated reference: UniProt O53830 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor mshD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000867|Rv0818|
MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLPSTGPAEIDARLRLVVGRRGDLADQESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPGRDGMQEPLVDPLRSQ