Rv0786c Resolved · high auto-curated
H37Rv Rv0786c · MTBC0 mtbc0_000836 ·
212 aa · 885501–886139 (-) ·
RefSeq NP_215300.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | MBL fold metallo-hydrolase |
| Revised (this work) | MBL fold metallo-hydrolase. Pfam: Lactamase_B_3 (PF13483.13), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71839
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Protein Rv0786c |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | beta-lactamase |
| Orthologous group | COG2220 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.168 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Lactamase_B_3 | PF13483.13 | 2.4e-18 | 2–177 | Beta-lactamase superfamily domain |
Lactamase_B | PF00753.34 | 1.5e-05 | 6–177 | Metallo-beta-lactamase superfamily |
Lactamase_B_2 | PF12706.14 | 8.3e-10 | 32–177 | Beta-lactamase superfamily domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: purQ (phosphoribosylformylglycinamidine synthase), high confidence from genomic context alone (score 715 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0787 hyp |
hypothetical protein | 794 | 793 ctx | neighborhood:792 |
Rv0788 purQ |
phosphoribosylformylglycinamidine synthase | 715 | 715 ctx | neighborhood:713 |
Rv0787A purS hyp |
hypothetical protein | 714 | 714 ctx | neighborhood:713 |
Rv2199c ctaF |
cytochrome c oxidase polypeptide 4 | 624 | 607 ctx | cooccurence:606 |
Rv3597c lsr2 |
iron-regulated H-NS-like protein | 546 | 546 ctx | cooccurence:546 |
Rv2194 qcrC |
ubiquinol-cytochrome C reductase cytochrome subunit C | 513 | 513 ctx | cooccurence:509 |
Rv3015c hyp |
hypothetical protein | 504 | 504 ctx | cooccurence:430 |
Rv0528 |
transmembrane protein | 476 | 476 ctx | cooccurence:473 |
Rv0360c hyp |
hypothetical protein | 456 | 457 ctx | cooccurence:456 |
Rv0638 secE1 |
preprotein translocase SecE | 452 | 453 ctx | cooccurence:451 |
Rv0142 hyp |
hypothetical protein | 442 | 443 ctx | cooccurence:425 |
Rv2969c hyp |
hypothetical protein | 418 | 419 ctx | cooccurence:417 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 415 | 415 ctx | cooccurence:412 |
Rv2475c hyp |
hypothetical protein | 412 | 412 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: MBL fold metallo-hydrolase
- Pfam (hmmscan --cut_ga): Lactamase_B_3 PF13483.13 (E=2e-18), Lactamase_B PF00753.34 (E=2e-05), Lactamase_B_2 PF12706.14 (E=8e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215300.2)
- Domains: Pfam-A via hmmscan --cut_ga — Lactamase_B_3 (PF13483.13), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2220 - Curated reference: UniProt P71839 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
purQ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000836|Rv0786c| MQLTHFGHSCLLAEFGQTRLLFDPGTFSHGFEGITGLSAILITHQHPDHIDVTRLPTLLEDNPAAELYADPQTAAQLGEPWRAVHVGDELPLAELTVRAVGGCHAVIHPEIPVIENISYLVGDSKHRARLMHPGDALFVPGEQVDVLATPAAAPWMKISEAVDYLRAVAPARAVPIHQAIVAPDARGIYYGRLTEMTTTDFQVLPEESAVTF