Rv0786c Resolved · high auto-curated

H37Rv Rv0786c · MTBC0 mtbc0_000836 · 212 aa · 885501–886139 (-) · RefSeq NP_215300.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMBL fold metallo-hydrolase
Revised (this work)MBL fold metallo-hydrolase. Pfam: Lactamase_B_3 (PF13483.13), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71839 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein Rv0786c

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionbeta-lactamase
Orthologous groupCOG2220

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.168 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lactamase_B_3PF13483.13 2.4e-182–177 Beta-lactamase superfamily domain
Lactamase_BPF00753.34 1.5e-056–177 Metallo-beta-lactamase superfamily
Lactamase_B_2PF12706.14 8.3e-1032–177 Beta-lactamase superfamily domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: purQ (phosphoribosylformylglycinamidine synthase), high confidence from genomic context alone (score 715 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0787 hyp hypothetical protein 794 793 ctx neighborhood:792
Rv0788 purQ phosphoribosylformylglycinamidine synthase 715 715 ctx neighborhood:713
Rv0787A purS hyp hypothetical protein 714 714 ctx neighborhood:713
Rv2199c ctaF cytochrome c oxidase polypeptide 4 624 607 ctx cooccurence:606
Rv3597c lsr2 iron-regulated H-NS-like protein 546 546 ctx cooccurence:546
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 513 513 ctx cooccurence:509
Rv3015c hyp hypothetical protein 504 504 ctx cooccurence:430
Rv0528 transmembrane protein 476 476 ctx cooccurence:473
Rv0360c hyp hypothetical protein 456 457 ctx cooccurence:456
Rv0638 secE1 preprotein translocase SecE 452 453 ctx cooccurence:451
Rv0142 hyp hypothetical protein 442 443 ctx cooccurence:425
Rv2969c hyp hypothetical protein 418 419 ctx cooccurence:417
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 415 415 ctx cooccurence:412
Rv2475c hyp hypothetical protein 412 412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MBL fold metallo-hydrolase
  • Pfam (hmmscan --cut_ga): Lactamase_B_3 PF13483.13 (E=2e-18), Lactamase_B PF00753.34 (E=2e-05), Lactamase_B_2 PF12706.14 (E=8e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215300.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Lactamase_B_3 (PF13483.13), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2220
  • Curated reference: UniProt P71839 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor purQ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000836|Rv0786c|
MQLTHFGHSCLLAEFGQTRLLFDPGTFSHGFEGITGLSAILITHQHPDHIDVTRLPTLLEDNPAAELYADPQTAAQLGEPWRAVHVGDELPLAELTVRAVGGCHAVIHPEIPVIENISYLVGDSKHRARLMHPGDALFVPGEQVDVLATPAAAPWMKISEAVDYLRAVAPARAVPIHQAIVAPDARGIYYGRLTEMTTTDFQVLPEESAVTF