purQ Family assigned · medium auto-curated
H37Rv Rv0788 · MTBC0 mtbc0_000839 ·
224 aa · 887186–887860 (+) ·
RefSeq NP_215303.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phosphoribosylformylglycinamidine synthase |
|---|---|
| MTBC0 PGAP re-annotation | phosphoribosylformylglycinamidine synthase subunit PurQ |
| Revised (this work) | Phosphoribosylformylglycinamidine synthase subunit PurQ. Pfam: GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WHL5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosylformylglycinamidine synthase subunit PurQ |
| EC (curated) |
EC 3.5.1.2, EC 6.3.5.3
|
| Curated function | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to Pur. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | purQ |
| eggNOG description | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL |
| Orthologous group | COG0047 |
| EC number |
EC 6.3.5.3
|
| KEGG orthology |
K01952
|
| KEGG pathways |
map00230, map01100, map01110, map01130
|
| KEGG modules |
M00048
|
| Gene Ontology (11) |
GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GATase_5 | PF13507.13 | 1.3e-34 | 3–204 | CobB/CobQ-like glutamine amidotransferase domain |
GATase | PF00117.35 | 1.7e-05 | 20–96 | Glutamine amidotransferase class-I |
GATase_3 | PF07685.21 | 2.2e-08 | 25–96 | CobB/CobQ-like glutamine amidotransferase domain |
DJ-1_PfpI | PF01965.31 | 2.5e-06 | 36–101 | DJ-1/PfpI family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: purL (phosphoribosylformylglycinamidine synthase 2), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0787A purS hyp |
hypothetical protein | 999 | 1000 ctx | neighborhood:882 cooccurence:764 coexpression:863 experimental:790 database:900 textmining:590 |
Rv0803 purL |
phosphoribosylformylglycinamidine synthase 2 | 999 | 1000 ctx | fusion:899 cooccurence:774 coexpression:861 experimental:836 database:900 textmining:408 |
Rv0809 purM |
phosphoribosylformylglycinamidine cyclo-ligase PurM | 998 | 998 ctx | fusion:552 cooccurence:646 coexpression:857 database:900 |
Rv0808 purF |
amidophosphoribosyltransferase | 996 | 996 ctx | cooccurence:690 coexpression:859 database:900 |
Rv0956 purN |
phosphoribosylglycinamide formyltransferase PurN | 995 | 992 ctx | cooccurence:451 coexpression:857 database:900 textmining:432 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 992 | 991 ctx | fusion:823 cooccurence:606 coexpression:857 |
Rv0389 purT |
phosphoribosylglycinamide formyltransferase PurT | 980 | 974 | coexpression:731 database:900 |
Rv3275c purE |
5-(carboxyamino)imidazole ribonucleotide mutase | 960 | 948 ctx | cooccurence:620 coexpression:858 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 949 | 947 | coexpression:463 database:900 |
Rv3276c purK |
5-(carboxyamino)imidazole ribonucleotide synthase | 946 | 929 ctx | cooccurence:479 coexpression:858 |
Rv0957 purH |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 942 | 925 ctx | cooccurence:436 coexpression:858 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 933 | 910 | database:900 |
Rv3436c glmS |
glucosamine--fructose-6-phosphate aminotransferase | 921 | 909 | database:900 |
Rv2476c gdh |
NAD-dependent glutamate dehydrogenase | 904 | 904 | database:900 |
Rv3859c gltB |
glutamate synthase large subunit | 903 | 904 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: phosphoribosylformylglycinamidine synthase
- MTBC0 PGAP product: phosphoribosylformylglycinamidine synthase subunit PurQ
- Pfam (hmmscan --cut_ga): GATase_5 PF13507.13 (E=1e-34), GATase PF00117.35 (E=2e-05), GATase_3 PF07685.21 (E=2e-08), DJ-1_PfpI PF01965.31 (E=3e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215303.1)
- Domains: Pfam-A via hmmscan --cut_ga — GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0047 - Curated reference: UniProt P9WHL5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
purL - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000839|Rv0788|purQ MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG