purQ Family assigned · medium auto-curated
H37Rv Rv0788 · MTBC0 mtbc0_000839 ·
224 aa ·
887186–887860 MTBC0
(+) ·
RefSeq NP_215303.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phosphoribosylformylglycinamidine synthase |
|---|---|
| MTBC0 PGAP re-annotation | phosphoribosylformylglycinamidine synthase subunit PurQ |
| Revised (this work) | Phosphoribosylformylglycinamidine synthase subunit PurQ. Pfam: GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | purS (Rv0787A, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -5.69 (95% CI -6.46 to -4.92). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in de novo purine biosynthesis (at the fourth step) [catalytic activity: ATP + 5'-phosphoribosylformylglycinamide + L-glutamine + H2O = ADP + phosphate + 5'-phosphoribosylformylglycinamidine + L-glutamate]. |
|---|---|
| Mycobrowser EC |
6.3.5.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0812
· 99.6% identity |
|---|---|
| M. leprae |
ML2219c
· 89.2% identity |
| M. marinum |
MMAR_4897
· 92.8% identity |
| M. smegmatis |
MSMEG_5831
· 82.1% identity |
| M. orygis |
RJtmp_000835
· 99.6% identity |
| M. abscessus |
MAB_0698
· 83.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHL5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosylformylglycinamidine synthase subunit PurQ |
| EC (curated) |
EC 3.5.1.2, EC 6.3.5.3
|
| Curated function | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to Pur. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | purQ |
| eggNOG description | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL |
| Orthologous group | COG0047 |
| EC number |
EC 6.3.5.3
|
| KEGG orthology |
K01952
|
| KEGG pathways |
map00230, map01100, map01110, map01130
|
| KEGG modules |
M00048
|
| Gene Ontology (11) |
GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 90.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 63.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 12 in the ORF — 12 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.083, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 211.0 ppm · rank 819/3519 (76.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 224 aa |
|---|---|
| Molecular weight | 23.6 kDa |
| Theoretical pI | 4.79 |
| GRAVY | 0.223 (hydrophobic) |
| Aliphatic index | 99.7 |
| Aromaticity | 0.071 |
| Instability index | 20.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GATase_5 | PF13507.13 | 1.3e-34 | 3–204 | CobB/CobQ-like glutamine amidotransferase domain |
GATase | PF00117.35 | 1.7e-05 | 20–96 | Glutamine amidotransferase class-I |
GATase_3 | PF07685.21 | 2.2e-08 | 25–96 | CobB/CobQ-like glutamine amidotransferase domain |
DJ-1_PfpI | PF01965.31 | 2.5e-06 | 36–101 | DJ-1/PfpI family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3d54-assembly3_D |
1.00 | 0.96 | 9.0e-28 sig | 3d54-assembly3_D Structure of PurLQS from Thermotoga maritima |
6jta-assembly1_A |
1.00 | 0.91 | 4.1e-18 sig | 6jta-assembly1_A Crystal Structure of D464A L465A mutant of FGAM Synthetase |
6jt8-assembly1_A |
1.00 | 0.91 | 7.5e-18 sig | 6jt8-assembly1_A Crystal structure of 450-451_deletion mutant of FGAM Synthetase |
6lyk-assembly1_A |
1.00 | 0.90 | 8.0e-18 sig | 6lyk-assembly1_A Crystal Structure of R1263A mutant of Formylglycinamidine Synthetase |
6lym-assembly1_A |
1.00 | 0.91 | 1.4e-17 sig | 6lym-assembly1_A Crystal structure of D657A mutant of formylglycinamidine synthetase |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0787A (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0789c (- strand, 16 bp gap) |
| Predicted operon |
Rv0787A · purQ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: purL (phosphoribosylformylglycinamidine synthase 2), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0787A purS hyp exp |
hypothetical protein | 999 | 1000 ctx | neighborhood:882 cooccurence:764 coexpression:863 experimental:790 database:900 textmining:590 |
Rv0803 purL exp |
phosphoribosylformylglycinamidine synthase 2 | 999 | 1000 ctx | fusion:899 cooccurence:774 coexpression:861 experimental:836 database:900 textmining:408 |
Rv0809 purM exp |
phosphoribosylformylglycinamidine cyclo-ligase PurM | 998 | 998 ctx | fusion:552 cooccurence:646 coexpression:857 database:900 |
Rv0808 purF exp |
amidophosphoribosyltransferase | 996 | 996 ctx | cooccurence:690 coexpression:859 database:900 |
Rv0956 purN exp |
phosphoribosylglycinamide formyltransferase PurN | 995 | 992 ctx | cooccurence:451 coexpression:857 database:900 textmining:432 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 992 | 991 ctx | fusion:823 cooccurence:606 coexpression:857 |
Rv0389 purT exp |
phosphoribosylglycinamide formyltransferase PurT | 980 | 974 | coexpression:731 database:900 |
Rv3275c purE |
5-(carboxyamino)imidazole ribonucleotide mutase | 960 | 948 ctx | cooccurence:620 coexpression:858 |
Rv1383 carA exp |
carbamoyl-phosphate synthase small subunit | 949 | 947 | coexpression:463 database:900 |
Rv3276c purK |
5-(carboxyamino)imidazole ribonucleotide synthase | 946 | 929 ctx | cooccurence:479 coexpression:858 |
Rv0957 purH |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 942 | 925 ctx | cooccurence:436 coexpression:858 |
Rv1384 carB exp |
carbamoyl-phosphate synthase large subunit | 933 | 910 | database:900 |
Rv3436c glmS exp |
glucosamine--fructose-6-phosphate aminotransferase | 921 | 909 | database:900 |
Rv2476c gdh exp |
NAD-dependent glutamate dehydrogenase | 904 | 904 | database:900 |
Rv3859c gltB exp |
glutamate synthase large subunit | 903 | 904 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: phosphoribosylformylglycinamidine synthase
- MTBC0 PGAP product: phosphoribosylformylglycinamidine synthase subunit PurQ
- Pfam (hmmscan --cut_ga): GATase_5 PF13507.13 (E=1e-34), GATase PF00117.35 (E=2e-05), GATase_3 PF07685.21 (E=2e-08), DJ-1_PfpI PF01965.31 (E=3e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215303.1)
- Domains: Pfam-A via hmmscan --cut_ga — GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0047 - Curated reference: UniProt P9WHL5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
purL - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000839|Rv0788|purQ MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for purQ? Email the maintainer — the message is pre-filled with this gene's details.