purQ Family assigned · medium auto-curated

H37Rv Rv0788 · MTBC0 mtbc0_000839 · 224 aa · 887186–887860 (+) · RefSeq NP_215303.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphoribosylformylglycinamidine synthase
MTBC0 PGAP re-annotationphosphoribosylformylglycinamidine synthase subunit PurQ
Revised (this work)Phosphoribosylformylglycinamidine synthase subunit PurQ. Pfam: GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHL5 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphoribosylformylglycinamidine synthase subunit PurQ
EC (curated) EC 3.5.1.2, EC 6.3.5.3
Curated functionPart of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to Pur.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepurQ
eggNOG descriptionPart of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL
Orthologous groupCOG0047
EC number EC 6.3.5.3
KEGG orthology K01952
KEGG pathways map00230, map01100, map01110, map01130
KEGG modules M00048
Gene Ontology (11) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GATase_5PF13507.13 1.3e-343–204 CobB/CobQ-like glutamine amidotransferase domain
GATasePF00117.35 1.7e-0520–96 Glutamine amidotransferase class-I
GATase_3PF07685.21 2.2e-0825–96 CobB/CobQ-like glutamine amidotransferase domain
DJ-1_PfpIPF01965.31 2.5e-0636–101 DJ-1/PfpI family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: purL (phosphoribosylformylglycinamidine synthase 2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0787A purS hyp hypothetical protein 999 1000 ctx neighborhood:882 cooccurence:764 coexpression:863 experimental:790 database:900 textmining:590
Rv0803 purL phosphoribosylformylglycinamidine synthase 2 999 1000 ctx fusion:899 cooccurence:774 coexpression:861 experimental:836 database:900 textmining:408
Rv0809 purM phosphoribosylformylglycinamidine cyclo-ligase PurM 998 998 ctx fusion:552 cooccurence:646 coexpression:857 database:900
Rv0808 purF amidophosphoribosyltransferase 996 996 ctx cooccurence:690 coexpression:859 database:900
Rv0956 purN phosphoribosylglycinamide formyltransferase PurN 995 992 ctx cooccurence:451 coexpression:857 database:900 textmining:432
Rv0772 purD phosphoribosylamine--glycine ligase 992 991 ctx fusion:823 cooccurence:606 coexpression:857
Rv0389 purT phosphoribosylglycinamide formyltransferase PurT 980 974 coexpression:731 database:900
Rv3275c purE 5-(carboxyamino)imidazole ribonucleotide mutase 960 948 ctx cooccurence:620 coexpression:858
Rv1383 carA carbamoyl-phosphate synthase small subunit 949 947 coexpression:463 database:900
Rv3276c purK 5-(carboxyamino)imidazole ribonucleotide synthase 946 929 ctx cooccurence:479 coexpression:858
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 942 925 ctx cooccurence:436 coexpression:858
Rv1384 carB carbamoyl-phosphate synthase large subunit 933 910 database:900
Rv3436c glmS glucosamine--fructose-6-phosphate aminotransferase 921 909 database:900
Rv2476c gdh NAD-dependent glutamate dehydrogenase 904 904 database:900
Rv3859c gltB glutamate synthase large subunit 903 904 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphoribosylformylglycinamidine synthase
  • MTBC0 PGAP product: phosphoribosylformylglycinamidine synthase subunit PurQ
  • Pfam (hmmscan --cut_ga): GATase_5 PF13507.13 (E=1e-34), GATase PF00117.35 (E=2e-05), GATase_3 PF07685.21 (E=2e-08), DJ-1_PfpI PF01965.31 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215303.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GATase_5 (PF13507.13), GATase (PF00117.35), GATase_3 (PF07685.21), DJ-1_PfpI (PF01965.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0047
  • Curated reference: UniProt P9WHL5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor purL
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000839|Rv0788|purQ
MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG