Rv0360c Still unknown · low auto-curated
H37Rv Rv0360c · MTBC0 - ·
145 aa · 438302–438739 (-) ·
RefSeq NP_214874.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF3151. Function unknown. Foldseek best (non-significant) hit: 8ump-assembly1_A T33-ml35 - Designed Tetrahedral Protein Cage Using Ma (prob 1.00, TM 0.56). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O06310
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF3151) |
| Orthologous group | 2DMMI |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.356 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3151 | PF11349.14 | 6.0e-59 | 17–140 | Protein of unknown function (DUF3151) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 88.8 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8ump-assembly1_A |
1.00 | 0.56 | 3.3e-02 | 8ump-assembly1_A T33-ml35 - Designed Tetrahedral Protein Cage Using Machine Learning Algorithms |
4gcn-assembly2_B |
0.99 | 0.58 | 1.1e-01 | 4gcn-assembly2_B N-terminal domain of stress-induced protein-1 (STI-1) from C.elegans |
6gxz-assembly1_A |
0.97 | 0.60 | 4.4e-01 | 6gxz-assembly1_A Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex |
1na3-assembly1_A |
0.97 | 0.67 | 5.2e-01 | 1na3-assembly1_A Design of Stable alpha-Helical Arrays from an Idealized TPR Motif |
6gxz-assembly2_C |
0.97 | 0.60 | 4.9e-01 | 6gxz-assembly2_C Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex |
8fwd-assembly1_C |
0.96 | 0.56 | 3.8e-01 | 8fwd-assembly1_C Fast and versatile sequence- independent protein docking for nanomaterials design using RPXDock |
3fwv-assembly2_B |
0.94 | 0.57 | 4.0e-01 | 3fwv-assembly2_B Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide |
2e2e-assembly1_B |
0.92 | 0.54 | 2.8e-01 | 2e2e-assembly1_B TPR domain of NrfG mediates the complex formation between heme lyase and formate-dependent nitrite reductase in Escherichia Coli O157:H7 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mca (mycothiol S-conjugate amidase), high confidence from genomic context alone (score 741 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1082 mca |
mycothiol S-conjugate amidase | 741 | 741 ctx | cooccurence:741 |
Rv2466c hyp |
hypothetical protein | 747 | 738 ctx | cooccurence:738 |
Rv0361 |
membrane protein | 726 | 726 ctx | neighborhood:726 |
Rv0819 mshD |
mycothiol acetyltransferase | 696 | 696 ctx | cooccurence:693 |
Rv2199c ctaF |
cytochrome c oxidase polypeptide 4 | 657 | 657 ctx | cooccurence:657 |
Rv2260 hyp |
hypothetical protein | 649 | 650 ctx | cooccurence:648 |
Rv2194 qcrC |
ubiquinol-cytochrome C reductase cytochrome subunit C | 612 | 612 ctx | cooccurence:610 |
Rv1170 mshB |
1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase | 601 | 601 ctx | cooccurence:601 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 583 | 583 ctx | cooccurence:582 |
Rv0528 |
transmembrane protein | 564 | 564 ctx | cooccurence:562 |
Rv1457c |
antibiotic ABC transporter permease | 536 | 518 ctx | cooccurence:518 |
Rv0498 hyp |
hypothetical protein | 516 | 516 ctx | cooccurence:516 |
Rv0801 hyp |
hypothetical protein | 515 | 515 ctx | cooccurence:512 |
Rv2917 hyp |
hypothetical protein | 510 | 511 ctx | cooccurence:478 |
Rv2286c hyp |
hypothetical protein | 495 | 496 ctx | cooccurence:490 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DUF3151 PF11349.14 (E=6e-59)
- Foldseek best: 8ump-assembly1_A T33-ml35 - Designed Tetrahedral Protein Cage Using Machine Lear (prob 1.00, E=3e-02, TM=0.56)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214874.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3151 (PF11349.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DMMI - Curated reference: UniProt O06310 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 88.8, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
33 functional partner(s); context anchor
mca - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0360c| MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAAHPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRGFLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL