whiB7 Family assigned · medium auto-curated
H37Rv Rv3197A · MTBC0 - ·
92 aa ·
3568401–3568679 H37Rv
(-) ·
RefSeq YP_177940.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator WhiB7 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Transcriptional regulator WhiB7. Pfam: Whib (PF02467.22), AT_hook (PF02178.25). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 80 publications
80 TB publications mention this gene. 80 publication(s) discuss this gene (47 in a M. tuberculosis context, 39 in other mycobacteria — M. abscessus (28), M. smegmatis (14), M. marinum (1)).
| Publication | Date |
|---|---|
| Activation of the antibiotic resistance factor WhiB7 can stimulate aggregate biofilm formation in stationary phase Mycobacterium smegmatis by reinitiating translation. doi:10.1128/jb.00076-26 | 2026 |
| Alanine dependence of trans-translation contributes to riboregulation of mycobacterial antibiotic recalcitrance genes. doi:10.1101/2025.10.10.681568 | 2025 |
| Tobramycin enhances Mycobacterium abscessus fitness through whiB7 induction. doi:10.1101/2025.10.01.679559 | 2025 |
| Prodrug florfenicol amine is activated by intrinsic resistance to target Mycobacterium abscessus. doi:10.1038/s41564-025-02147-9 | 2025 |
| Correction to: A single upstream mutation of whiB7 underlies amikacin and clarithromycin resistance in Mycobacterium abscessus. doi:10.1093/jambio/lxaf106 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 96% of residues (metapredict) · mean AlphaFold pLDDT 89.3 |
|---|---|
| Disordered regions | 1 IDR(s), longest 92 aa [0-92] |
sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB7 (whiB7).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -0.17 (95% CI -1.39 to 1.07). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in transcriptional mechanism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3221c
· 98.9% identity |
|---|---|
| M. leprae |
ML0639
· 69.3% identity |
| M. marinum |
MMAR_1365
· 76.9% identity |
| M. smegmatis |
MSMEG_1953
· 75.3% identity |
| M. orygis |
RJtmp_003293
· 98.9% identity |
| M. abscessus |
MAB_3508c
· 74.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
Q6MX01
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable transcriptional regulator WhiB7 |
| Curated function | The apo- but not holo-form probably binds DNA (By similarity). Acts as a transcriptional regulator. Probably redox-responsive. Upon overproduction at least 10 other genes are up-regulated, among them are Rv1258c, Rv1988, Rv2301, Rv2416c, Rv2725c and whiB7 itself. Probably redox-responsive. The apo-form has been shown to act as a protein disulfide reductase. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | whiB7 |
| eggNOG description | Acts as a transcriptional regulator. Probably redox- responsive. The apo- but not holo-form probably binds DNA |
| Orthologous group | 2DMIS |
| KEGG orthology |
K18958
|
| Gene Ontology (9) |
GO:0001101, GO:0008150, GO:0010033, GO:0033993, GO:0042221, GO:0046677, GO:0050896, GO:0070542, GO:1901700
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 5.94% of strains (8630) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 75.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 65.3% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 96.4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Physico-chemical properties (computed, ProtParam)
| Length | 92 aa |
|---|---|
| Molecular weight | 10.1 kDa |
| Theoretical pI | 9.57 |
| GRAVY | -0.225 (hydrophilic) |
| Aliphatic index | 84.8 |
| Aromaticity | 0.054 |
| Instability index | 56.9 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Whib | PF02467.22 | 4.7e-14 | 20–68 | Transcription factor WhiB |
AT_hook | PF02178.25 | 5.9e-03 | 80–91 | AT hook motif |
Experimental structures (Protein Data Bank) 4 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7kuf |
X-ray diffraction | 2.6 Å | 100% |
7kif |
Electron Microscopy | 2.94 Å | 100% |
7kim |
Electron Microscopy | 3.38 Å | 100% |
7kug |
X-ray diffraction | 1.55 Å | 86% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7kuf-assembly1_A |
1.00 | 0.92 | 1.9e-12 sig | 7kuf-assembly1_A Transcription activation subcomplex with WhiB7 bound to SigmaAr4-RNAP Beta flap tip chimera and DNA |
7kug-assembly2_C |
1.00 | 0.94 | 2.0e-10 sig | 7kug-assembly2_C Fe-S cluster-bound transcription activator WhiB7 in complex with the SigmaAr4-RNAP Beta flap tip chimera |
7kim-assembly1_Z |
1.00 | 0.81 | 1.3e-11 sig | 7kim-assembly1_Z Mycobacterium tuberculosis WT RNAP transcription closed promoter complex with WhiB7 transcription factor |
7kif-assembly1_Z |
1.00 | 0.85 | 4.0e-11 sig | 7kif-assembly1_Z Mycobacterium tuberculosis WT RNAP transcription open promoter complex with WhiB7 transcription factor |
6onu-assembly3_E |
1.00 | 0.78 | 2.9e-03 sig | 6onu-assembly3_E Complex structure of WhiB1 and region 4 of SigA in P21 space group. |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3197 (+ strand, 33 bp gap) |
|---|---|
| Downstream (3' on genome) | uvrD2 (- strand, 429 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0135c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1417 (membrane protein), medium confidence from genomic context alone (score 478 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2703 sigA exp |
RNA polymerase sigma factor SigA | 999 | 999 | experimental:999 |
Rv0668 rpoC exp |
DNA-directed RNA polymerase subunit beta' | 999 | 999 | experimental:999 |
Rv0667 rpoB exp |
DNA-directed RNA polymerase subunit beta | 965 | 899 | experimental:898 textmining:677 |
Rv3457c rpoA exp |
DNA-directed RNA polymerase subunit alpha | 910 | 899 | experimental:898 |
Rv2050 rbpA exp |
RNA polymerase-binding protein RbpA | 902 | 899 | experimental:898 |
Rv1390 rpoZ exp |
DNA-directed RNA polymerase subunit omega | 898 | 899 | experimental:898 |
Rv3583c carD exp |
RNA polymerase-binding transcription factor CarD | 898 | 898 | experimental:898 |
Rv2710 sigB exp |
RNA polymerase sigma factor SigB | 828 | 822 | experimental:821 |
Rv0487 hyp |
hypothetical protein | 596 | 596 ctx | cooccurence:595 |
Rv0801 hyp |
hypothetical protein | 513 | 513 ctx | cooccurence:513 |
Rv0498 hyp |
hypothetical protein | 510 | 511 ctx | cooccurence:508 |
Rv1417 |
membrane protein | 477 | 478 ctx | cooccurence:476 |
Rv0244c fadE5 |
acyl-CoA dehydrogenase FadE5 | 465 | 465 ctx | cooccurence:465 |
Rv3780 bpa hyp |
hypothetical protein | 432 | 432 ctx | cooccurence:432 |
Rv1467c fadE15 |
acyl-CoA dehydrogenase | 430 | 430 ctx | cooccurence:425 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator WhiB7
- Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=5e-14), AT_hook PF02178.25 (E=6e-03)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177940.1)
- Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22), AT_hook (PF02178.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DMIS - Curated reference: UniProt Q6MX01 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
Rv1417 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3197A|whiB7 MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for whiB7? Email the maintainer — the message is pre-filled with this gene's details.