whiB7 Family assigned · medium auto-curated

H37Rv Rv3197A · MTBC0 - · 92 aa · 3568401–3568679 (-) · RefSeq YP_177940.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator WhiB7
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator WhiB7. Pfam: Whib (PF02467.22), AT_hook (PF02178.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MX01 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable transcriptional regulator WhiB7
Curated functionThe apo- but not holo-form probably binds DNA (By similarity). Acts as a transcriptional regulator. Probably redox-responsive. Upon overproduction at least 10 other genes are up-regulated, among them are Rv1258c, Rv1988, Rv2301, Rv2416c, Rv2725c and whiB7 itself. Probably redox-responsive. The apo-form has been shown to act as a protein disulfide reductase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namewhiB7
eggNOG descriptionActs as a transcriptional regulator. Probably redox- responsive. The apo- but not holo-form probably binds DNA
Orthologous group2DMIS
KEGG orthology K18958
Gene Ontology (9) GO:0001101, GO:0008150, GO:0010033, GO:0033993, GO:0042221, GO:0046677, GO:0050896, GO:0070542, GO:1901700

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 5.94% of strains (8630) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WhibPF02467.22 4.7e-1420–68 Transcription factor WhiB
AT_hookPF02178.25 5.9e-0380–91 AT hook motif

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1417 (membrane protein), medium confidence from genomic context alone (score 478 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2703 sigA RNA polymerase sigma factor SigA 999 999 experimental:999
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 999 999 experimental:999
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 965 899 experimental:898 textmining:677
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 910 899 experimental:898
Rv2050 rbpA RNA polymerase-binding protein RbpA 902 899 experimental:898
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 898 899 experimental:898
Rv3583c carD RNA polymerase-binding transcription factor CarD 898 898 experimental:898
Rv2710 sigB RNA polymerase sigma factor SigB 828 822 experimental:821
Rv0487 hyp hypothetical protein 596 596 ctx cooccurence:595
Rv0801 hyp hypothetical protein 513 513 ctx cooccurence:513
Rv0498 hyp hypothetical protein 510 511 ctx cooccurence:508
Rv1417 membrane protein 477 478 ctx cooccurence:476
Rv0244c fadE5 acyl-CoA dehydrogenase FadE5 465 465 ctx cooccurence:465
Rv3780 bpa hyp hypothetical protein 432 432 ctx cooccurence:432
Rv1467c fadE15 acyl-CoA dehydrogenase 430 430 ctx cooccurence:425

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator WhiB7
  • Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=5e-14), AT_hook PF02178.25 (E=6e-03)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177940.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22), AT_hook (PF02178.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DMIS
  • Curated reference: UniProt Q6MX01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv1417
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3197A|whiB7
MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA