Rv0791c Resolved · high auto-curated
H37Rv Rv0791c · MTBC0 mtbc0_000842 ·
347 aa · 889223–890266 (-) ·
RefSeq NP_215306.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | LLM class flavin-dependent oxidoreductase |
| Revised (this work) | LLM class flavin-dependent oxidoreductase. Pfam: Bac_luciferase (PF00296.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6X9T8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | F420-dependent |
| Orthologous group | COG2141 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.461 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Bac_luciferase | PF00296.27 | 3.2e-48 | 22–277 | Luciferase-like monooxygenase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0792c (transcriptional regulator), high confidence from genomic context alone (score 885 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0790c hyp |
hypothetical protein | 998 | 987 ctx | neighborhood:882 coexpression:860 textmining:870 |
Rv0792c |
transcriptional regulator | 976 | 885 ctx | neighborhood:881 textmining:806 |
Rv0789c hyp |
hypothetical protein | 966 | 752 ctx | neighborhood:750 textmining:870 |
Rv0793 |
monooxygenase | 965 | 748 ctx | neighborhood:639 textmining:870 |
Rv3072c hyp |
hypothetical protein | 756 | 743 ctx | cooccurence:743 |
Rv3262 fbiB |
coenzyme F420:L-glutamate ligase | 726 | 698 ctx | cooccurence:660 |
Rv3261 fbiA |
2-phospho-L-lactate transferase | 711 | 696 ctx | cooccurence:686 |
Rv3178 |
nitroreductase | 670 | 649 ctx | cooccurence:647 |
Rv3547 ddn |
deazaflavin-dependent nitroreductase | 660 | 639 ctx | cooccurence:637 |
Rv1261c hyp |
hypothetical protein | 636 | 636 ctx | cooccurence:634 |
Rv1558 hyp |
hypothetical protein | 664 | 560 ctx | cooccurence:557 |
Rv2983 cofC |
2-phospho-L-lactate guanylyltransferase | 558 | 512 ctx | cooccurence:493 |
Rv2383c mbtB |
phenyloxazoline synthase | 455 | 425 | |
Rv1939 |
oxidoreductase | 424 | 402 | |
Rv3007c |
oxidoreductase | 412 | 390 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: LLM class flavin-dependent oxidoreductase
- Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=3e-48)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215306.1)
- Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2141 - Curated reference: UniProt I6X9T8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
Rv0792c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000842|Rv0791c| MNAKDDPHFGLMLAATVNGLAVGSYREMVVVSQTAEEYGFDSVWLCDHFLTISPGEYAKVAGIAADTGSATGTETGGAGQCAPSRSLPLLECWTALAALSRDTTKLRLGTSVLCNSYRHPSVLAKMAATLDVISQGRLDLGLGAGWFRRESQAYGIPFPPVGDRVSALAESLQVIKAVWTEPNPTYAGRFYTLDGATCDPPPVQRPHPPLWIGGEGDRVQRIAAKHAQGLNVRWWSPQQVTQRRGFLTQASEAAGRDPDTLRLSVTLLLAPTQSGEEEVRIREEFASIPEPGLIVGTPDRCVERIREYQDRGVGHFLFTIPHVVKSDYLHIIGSDIIPRVKTEVTIP