Rv0792c Family assigned · medium auto-curated
H37Rv Rv0792c · MTBC0 mtbc0_000843 ·
269 aa · 890263–891072 (-) ·
RefSeq NP_215307.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | GntR family transcriptional regulator |
| Revised (this work) | GntR family transcriptional regulator. Pfam: GntR (PF00392.28), UTRA (PF07702.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O86331
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | HTH-type transcriptional regulator Rv0792c |
| Curated function | Transcriptional regulator required for survival in oxidative stress and for establishing infection in host tissues. Regulates the expression of a subset of genes involved in oxidative stress adaptation and virulence, enabling the bacteria to adapt and persist in host tissues. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | GntR family |
| Orthologous group | COG2188 |
| KEGG orthology |
K03710
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.467 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GntR | PF00392.28 | 1.3e-16 | 24–85 | Bacterial regulatory proteins, gntR family |
UTRA | PF07702.19 | 2.6e-31 | 108–246 | UTRA domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0494 (HTH-type transcriptional regulator), high confidence from genomic context alone (score 857 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0790c hyp |
hypothetical protein | 977 | 888 ctx | neighborhood:818 textmining:806 |
Rv0791c hyp |
hypothetical protein | 976 | 885 ctx | neighborhood:881 textmining:806 |
Rv0494 |
HTH-type transcriptional regulator | 862 | 857 ctx | cooccurence:433 coexpression:757 |
Rv3833 |
AraC family transcriptional regulator | 842 | 826 | coexpression:820 |
Rv3060c |
GntR family transcriptional regulator | 811 | 805 | coexpression:764 |
Rv3183 higA3 |
transcriptional regulator | 814 | 803 | coexpression:802 |
Rv2912c |
TetR family HTH-type transcriptional regulator | 805 | 798 | coexpression:798 |
Rv1674c |
transcriptional regulator | 798 | 794 | coexpression:793 |
Rv3167c |
TetR family transcriptional regulator | 793 | 785 | coexpression:785 |
Rv0767c |
HTH-type transcriptional regulator | 793 | 785 | coexpression:785 |
Rv2621c |
transcriptional regulator | 791 | 778 | coexpression:778 |
Rv3066 |
DeoR family transcriptional regulator | 777 | 776 | coexpression:776 |
Rv2017 |
transcriptional regulator | 788 | 775 | coexpression:744 |
Rv3830c |
TetR family transcriptional regulator | 780 | 766 | coexpression:734 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 773 | 759 | coexpression:759 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator
- MTBC0 PGAP product: GntR family transcriptional regulator
- Pfam (hmmscan --cut_ga): GntR PF00392.28 (E=1e-16), UTRA PF07702.19 (E=3e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215307.1)
- Domains: Pfam-A via hmmscan --cut_ga — GntR (PF00392.28), UTRA (PF07702.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2188 - Curated reference: UniProt O86331 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
56 functional partner(s); context anchor
Rv0494 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000843|Rv0792c| MTSVKLDLDAADLRISRGSVPASTQLAEALKAQIIQQRLPRGGRLPSERELIDRSGLSRVTVRAAVGMLQRQGWLVRRQGLGTFVADPVEQELSCGVRTITEVLLSCGVTPQVDVLSHQTGPAPQRISETLGLVEVLCIRRRIRTGDQPLALVTAYLPPGVGPAVEPLLSGSADTETTYAMWERRLGVRIAQATHEIHAAGASPDVADALGLAVGSPVLVVDRTSYTNDGKPLEVVVFHHRPERYQFSVTLPRTLPGSGAGIIEKRDFA