Rv0792c Family assigned · medium auto-curated

H37Rv Rv0792c · MTBC0 mtbc0_000843 · 269 aa · 890263–891072 (-) · RefSeq NP_215307.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationGntR family transcriptional regulator
Revised (this work)GntR family transcriptional regulator. Pfam: GntR (PF00392.28), UTRA (PF07702.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O86331 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator Rv0792c
Curated functionTranscriptional regulator required for survival in oxidative stress and for establishing infection in host tissues. Regulates the expression of a subset of genes involved in oxidative stress adaptation and virulence, enabling the bacteria to adapt and persist in host tissues.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionGntR family
Orthologous groupCOG2188
KEGG orthology K03710

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.467 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GntRPF00392.28 1.3e-1624–85 Bacterial regulatory proteins, gntR family
UTRAPF07702.19 2.6e-31108–246 UTRA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0494 (HTH-type transcriptional regulator), high confidence from genomic context alone (score 857 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0790c hyp hypothetical protein 977 888 ctx neighborhood:818 textmining:806
Rv0791c hyp hypothetical protein 976 885 ctx neighborhood:881 textmining:806
Rv0494 HTH-type transcriptional regulator 862 857 ctx cooccurence:433 coexpression:757
Rv3833 AraC family transcriptional regulator 842 826 coexpression:820
Rv3060c GntR family transcriptional regulator 811 805 coexpression:764
Rv3183 higA3 transcriptional regulator 814 803 coexpression:802
Rv2912c TetR family HTH-type transcriptional regulator 805 798 coexpression:798
Rv1674c transcriptional regulator 798 794 coexpression:793
Rv3167c TetR family transcriptional regulator 793 785 coexpression:785
Rv0767c HTH-type transcriptional regulator 793 785 coexpression:785
Rv2621c transcriptional regulator 791 778 coexpression:778
Rv3066 DeoR family transcriptional regulator 777 776 coexpression:776
Rv2017 transcriptional regulator 788 775 coexpression:744
Rv3830c TetR family transcriptional regulator 780 766 coexpression:734
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 773 759 coexpression:759

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: GntR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): GntR PF00392.28 (E=1e-16), UTRA PF07702.19 (E=3e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215307.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GntR (PF00392.28), UTRA (PF07702.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2188
  • Curated reference: UniProt O86331 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor Rv0494
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000843|Rv0792c|
MTSVKLDLDAADLRISRGSVPASTQLAEALKAQIIQQRLPRGGRLPSERELIDRSGLSRVTVRAAVGMLQRQGWLVRRQGLGTFVADPVEQELSCGVRTITEVLLSCGVTPQVDVLSHQTGPAPQRISETLGLVEVLCIRRRIRTGDQPLALVTAYLPPGVGPAVEPLLSGSADTETTYAMWERRLGVRIAQATHEIHAAGASPDVADALGLAVGSPVLVVDRTSYTNDGKPLEVVVFHHRPERYQFSVTLPRTLPGSGAGIIEKRDFA