Rv2560 Family assigned · low

H37Rv Rv2560 · MTBC0 mtbc0_002728 · 325 aa · 2903620–2904597 (+) · RefSeq NP_217076.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF2189 domain-containing protein
Revised (this work)Membrane protein (33 kDa) localised to the mycobacterial membrane (immuno-EM); its high-activity binding peptides bind alveolar epithelial (A549) and monocyte (U937) cells and inhibit host-cell invasion, implicating it in adhesion/invasion of monocytes and epithelial cells. Molecular function unfixed.

Curated reference (UniProt)

UniProt P9WLA1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2560

UniProt still lists this protein as Uncharacterized protein Rv2560; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
eggNOG descriptionZn-ribbon protein possibly nucleic acid-binding
Orthologous groupCOG5473
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.699 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7w5z-assembly1_c3 0.33 0.45 2.7e+00 7w5z-assembly1_c3 Cryo-EM structure of Tetrahymena thermophila mitochondrial complex IV, composite dimer model
5gpy-assembly1_A 0.28 0.55 6.8e+00 5gpy-assembly1_A Crystal structure of the human TFIIE complex
8bqs-assembly1_Dc 0.16 0.43 5.4e+00 8bqs-assembly1_Dc Cryo-EM structure of the I-II-III2-IV2 respiratory supercomplex from Tetrahymena thermophila
8oyy-assembly2_B 0.12 0.24 1.2e+00 8oyy-assembly2_B De novo designed soluble GPCR-like fold GLF_32
2nrq-assembly1_A 0.11 0.38 7.9e+00 2nrq-assembly1_A Crystal structure of protein SSO0741 from Sulfolobus solfataricus, Pfam DUF54
8oyx-assembly2_B 0.08 0.29 4.6e+00 8oyx-assembly2_B De novo designed soluble GPCR-like fold GLF_18
6tjv-assembly1_F 0.07 0.23 3.2e+00 6tjv-assembly1_F Structure of the NDH-1MS complex from Thermosynechococcus elongatus
5oxf-assembly1_C 0.06 0.24 3.8e+00 5oxf-assembly1_C An oligomerised bacterial dynamin pair provides a mechanism for the long range sensing and tethering of membranes

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: papA2 (trehalose-2-sulfate acyltransferase), medium confidence from genomic context alone (score 667 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2559c hyp hypothetical protein 773 774 ctx neighborhood:773
Rv3820c papA2 trehalose-2-sulfate acyltransferase 666 667 ctx cooccurence:659
Rv1182 papA3 acyltransferase papA3 634 635 ctx cooccurence:634
Rv3824c papA1 acyltransferase 630 630 ctx cooccurence:630
Rv2566 hyp hypothetical protein 610 610 ctx neighborhood:609
Rv2567 hyp hypothetical protein 609 609 ctx neighborhood:609
Rv2923c hyp hypothetical protein 573 573 ctx cooccurence:573
Rv0538 membrane protein 568 569 ctx cooccurence:566
Rv0523c hyp hypothetical protein 562 562 ctx cooccurence:557
Rv2937 drrB daunorubicin ABC transporter permease DrrB 512 512 ctx cooccurence:512
Rv3903c cpnT hyp hypothetical protein 505 505 ctx cooccurence:505
Rv3181c vapB49 antitoxin VapB45 499 499 ctx cooccurence:499
Rv3033 hyp hypothetical protein 497 498 ctx cooccurence:496
Rv3732 hyp hypothetical protein 488 489 ctx cooccurence:487
Rv0801 hyp hypothetical protein 488 489 ctx cooccurence:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Membrane protein; binding peptides bind A549/U937 and inhibit invasion (Plaza 2007, PMID 18005255)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217076.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5473
  • Curated reference: UniProt P9WLA1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor papA2
  • Primary literature: Plaza DF, Curtidor H, Patarroyo MA, Chapeton-Montes JA, Reyes C, Barreto J, Patarroyo ME (2007). The Mycobacterium tuberculosis membrane protein Rv2560 - biochemical and functional studies FEBS J 274(24):6352-64. doi:10.1111/j.1742-4658.2007.06153.x PMID:18005255

Ancestral MTBC0 protein sequence

>mtbc0_002728|Rv2560|
MSQPPEHPGNPADPQGGNQGAGSYPPPGYGAPPPPPGYGPPPGTYLPPGYNAPPPPPGYGPPPGPPPPGYPTHLQSSGFSVGDAISWSWNRFTQNAVTLVVPVLAYAVALAAVIGATAGLVVALSDRATTAYTNTSGVSSESVDITMTPAAGIVMFLGYIALFALVLYMHAGILTGCLDIADGKPVTIATFFRPRNLGLVLVTGLLIVALTFIGGLLCVIPGLIFGFVAQFAVAFAVDRSTSPIDSVKASIETVGSNIGGSVLSWLAQLTAVLVGELLCFVGMLIGIPVAALIHVYTYRKLSGGQVVEAVRPAPPVGWPPGPQLA