Rv1727 Family assigned · medium auto-curated
H37Rv Rv1727 · MTBC0 mtbc0_001839 ·
189 aa · 1965285–1965854 (+) ·
RefSeq NP_216243.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | TIGR03086 family metal-binding protein |
| Revised (this work) | TIGR03086 family metal-binding protein. Pfam: MDMPI_N (PF11716.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71985
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Mycothiol maleylpyruvate isomerase N-terminal domain |
| Orthologous group | COG0596 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MDMPI_N | PF11716.14 | 3.9e-12 | 9–130 | Mycothiol maleylpyruvate isomerase N-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1726 (oxidoreductase), high confidence from genomic context alone (score 767 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1726 |
oxidoreductase | 767 | 767 ctx | neighborhood:712 |
Rv0801 hyp |
hypothetical protein | 571 | 571 ctx | cooccurence:555 |
Rv0080 hyp |
hypothetical protein | 538 | 539 ctx | cooccurence:536 |
Rv1725c hyp |
hypothetical protein | 511 | 512 ctx | neighborhood:505 |
Rv1724c hyp |
hypothetical protein | 507 | 508 ctx | neighborhood:505 |
Rv1749c |
integral membrane protein | 454 | 454 ctx | cooccurence:454 |
Rv0713 |
transmembrane protein | 447 | 447 ctx | cooccurence:447 |
Rv3788 hyp |
hypothetical protein | 445 | 446 ctx | cooccurence:425 |
Rv1775 hyp |
hypothetical protein | 432 | 433 ctx | cooccurence:430 |
Rv0444c rskA |
anti-sigma-K factor RskA | 429 | 430 ctx | cooccurence:428 |
Rv0736 rslA |
anti-sigma-L factor RslA | 425 | 426 ctx | cooccurence:414 |
Rv2164c hyp |
hypothetical protein | 425 | 426 ctx | cooccurence:421 |
Rv0802c |
succinyl-CoA transferase | 422 | 422 ctx | cooccurence:418 |
Rv1963c mce3R |
transcriptional repressor Mce3R | 416 | 417 ctx | cooccurence:413 |
Rv3903c cpnT hyp |
hypothetical protein | 415 | 415 ctx | cooccurence:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: TIGR03086 family metal-binding protein
- Pfam (hmmscan --cut_ga): MDMPI_N PF11716.14 (E=4e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216243.1)
- Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0596 - Curated reference: UniProt P71985 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
Rv1726 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001839|Rv1727| MDLYSNLVEAEQRLVALVSSIEADSYSSPTPCDRWDVRALLSHALASIDAFAAAVDGAPGPDMAQVFSGADIVGDDPLGATQRITRRSQAAWSTVRDLNAELSTFIGVMPAGQALAIITFSTVVHGWDLAVATGQAGELPEHLAEAAQQVAAELVPVLRPRGLFAHDVDLAGEATPTQRLVALTGRKPR