Rv1727 Family assigned · medium auto-curated

H37Rv Rv1727 · MTBC0 mtbc0_001839 · 189 aa · 1965285–1965854 (+) · RefSeq NP_216243.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR03086 family metal-binding protein
Revised (this work)TIGR03086 family metal-binding protein. Pfam: MDMPI_N (PF11716.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71985 TrEMBL · unreviewed · Predicted
UniProt nameMycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionMycothiol maleylpyruvate isomerase N-terminal domain
Orthologous groupCOG0596

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MDMPI_NPF11716.14 3.9e-129–130 Mycothiol maleylpyruvate isomerase N-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1726 (oxidoreductase), high confidence from genomic context alone (score 767 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1726 oxidoreductase 767 767 ctx neighborhood:712
Rv0801 hyp hypothetical protein 571 571 ctx cooccurence:555
Rv0080 hyp hypothetical protein 538 539 ctx cooccurence:536
Rv1725c hyp hypothetical protein 511 512 ctx neighborhood:505
Rv1724c hyp hypothetical protein 507 508 ctx neighborhood:505
Rv1749c integral membrane protein 454 454 ctx cooccurence:454
Rv0713 transmembrane protein 447 447 ctx cooccurence:447
Rv3788 hyp hypothetical protein 445 446 ctx cooccurence:425
Rv1775 hyp hypothetical protein 432 433 ctx cooccurence:430
Rv0444c rskA anti-sigma-K factor RskA 429 430 ctx cooccurence:428
Rv0736 rslA anti-sigma-L factor RslA 425 426 ctx cooccurence:414
Rv2164c hyp hypothetical protein 425 426 ctx cooccurence:421
Rv0802c succinyl-CoA transferase 422 422 ctx cooccurence:418
Rv1963c mce3R transcriptional repressor Mce3R 416 417 ctx cooccurence:413
Rv3903c cpnT hyp hypothetical protein 415 415 ctx cooccurence:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TIGR03086 family metal-binding protein
  • Pfam (hmmscan --cut_ga): MDMPI_N PF11716.14 (E=4e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216243.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0596
  • Curated reference: UniProt P71985 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv1726
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001839|Rv1727|
MDLYSNLVEAEQRLVALVSSIEADSYSSPTPCDRWDVRALLSHALASIDAFAAAVDGAPGPDMAQVFSGADIVGDDPLGATQRITRRSQAAWSTVRDLNAELSTFIGVMPAGQALAIITFSTVVHGWDLAVATGQAGELPEHLAEAAQQVAAELVPVLRPRGLFAHDVDLAGEATPTQRLVALTGRKPR