Rv0793 Family assigned · medium auto-curated

H37Rv Rv0793 · MTBC0 mtbc0_000844 · 101 aa · 891145–891450 (+) · RefSeq NP_215308.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)monooxygenase
MTBC0 PGAP re-annotationputative quinol monooxygenase
Revised (this work)Putative quinol monooxygenase. Pfam: ABM (PF03992.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O86332 SwissProt · reviewed · Evidence at protein level
UniProt namePutative monooxygenase Rv0793
EC (curated) EC 1.-.-.-
Curated functionPutative monooygenase that might be involved in antibiotic biosynthesis, or may act as reactive oxygen species scavenger that could help in evading host defenses.

UniProt still lists this protein as Putative monooxygenase Rv0793; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAntibiotic biosynthesis monooxygenase
Orthologous groupCOG1359
Gene Ontology (2) GO:0003674, GO:0003824

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABMPF03992.23 3.9e-194–78 Antibiotic biosynthesis monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0792c (transcriptional regulator), high confidence from genomic context alone (score 725 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0790c hyp hypothetical protein 968 765 ctx neighborhood:609 textmining:870
Rv0791c hyp hypothetical protein 965 748 ctx neighborhood:639 textmining:870
Rv0792c transcriptional regulator 945 725 ctx neighborhood:610 textmining:809
Rv0789c hyp hypothetical protein 935 527 ctx neighborhood:524 textmining:870
Rv2749 hyp hypothetical protein 435 436 ctx cooccurence:434
Rv1629 polA DNA polymerase I 415 416 coexpression:416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: monooxygenase
  • MTBC0 PGAP product: putative quinol monooxygenase
  • Pfam (hmmscan --cut_ga): ABM PF03992.23 (E=4e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215308.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABM (PF03992.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1359
  • Curated reference: UniProt O86332 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor Rv0792c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000844|Rv0793|
MTSPVAVIARFMPRPDARSALRALLDAMITPTRAEDGCRSYDLYESADGGELVLFERYRSRIALDEHRGSPHYLNYRAQVGELLTRPVAVTVLAPLDEASA