fucA Resolved · high auto-curated

H37Rv Rv0727c · MTBC0 mtbc0_000769 · 218 aa · 824036–824692 (-) · RefSeq NP_215241.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)L-fuculose phosphate aldolase FucA
MTBC0 PGAP re-annotationL-fuculose-phosphate aldolase
Revised (this work)L-fuculose-phosphate aldolase. Pfam: Aldolase_II (PF00596.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95075 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible L-fuculose phosphate aldolase FucA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namefucA
eggNOG descriptionAldolase
Orthologous groupCOG0235
EC number EC 4.1.1.104, EC 4.1.2.17, EC 5.1.3.4
KEGG orthology K01628, K03077, K22130
KEGG pathways map00040, map00051, map00053, map01100, map01120
KEGG modules M00550
Gene Ontology (55) GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005975, GO:0005996, GO:0006793, GO:0006796 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.07 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aldolase_IIPF00596.28 1.3e-5011–186 Class II Aldolase and Adducin N-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: serA2 (D-3-phosphoglycerate dehydrogenase SerA), high confidence from genomic context alone (score 964 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0728c serA2 D-3-phosphoglycerate dehydrogenase SerA 965 964 ctx neighborhood:882 coexpression:608
Rv1438 tpi triosephosphate isomerase 941 923 database:900
Rv0729 xylB D-xylulose kinase XylB 936 916 ctx neighborhood:790 coexpression:445
Rv0363c fba fructose-bisphosphate aldolase 924 909 database:900
Rv2498c citE citrate (pro-3S)-lyase subunit beta 731 732 coexpression:732
Rv3075c hyp hypothetical protein 730 730 coexpression:730
Rv0730 GCN5-like N-acetyltransferase 619 603 ctx neighborhood:601
Rv1972 Mce associated membrane protein 540 519 database:445
Rv1973 Mce associated membrane protein 539 518 database:445
Rv0178 Mce associated membrane protein 536 515 database:445
Rv3492c Mce associated protein 535 514 database:445
Rv1363c membrane protein 535 514 database:445
Rv1362c membrane protein 535 514 database:445
Rv0177 Mce associated protein 534 512 database:445
Rv0200 transmembrane protein 534 512 database:445

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: L-fuculose phosphate aldolase FucA
  • MTBC0 PGAP product: L-fuculose-phosphate aldolase
  • Pfam (hmmscan --cut_ga): Aldolase_II PF00596.28 (E=1e-50)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215241.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aldolase_II (PF00596.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0235
  • Curated reference: UniProt P95075 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor serA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000769|Rv0727c|fucA
MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL