fucA Resolved · high auto-curated
H37Rv Rv0727c · MTBC0 mtbc0_000769 ·
218 aa · 824036–824692 (-) ·
RefSeq NP_215241.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | L-fuculose phosphate aldolase FucA |
|---|---|
| MTBC0 PGAP re-annotation | L-fuculose-phosphate aldolase |
| Revised (this work) | L-fuculose-phosphate aldolase. Pfam: Aldolase_II (PF00596.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P95075
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible L-fuculose phosphate aldolase FucA |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | fucA |
| eggNOG description | Aldolase |
| Orthologous group | COG0235 |
| EC number |
EC 4.1.1.104, EC 4.1.2.17, EC 5.1.3.4
|
| KEGG orthology |
K01628, K03077, K22130
|
| KEGG pathways |
map00040, map00051, map00053, map01100, map01120
|
| KEGG modules |
M00550
|
| Gene Ontology (55) |
GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005975, GO:0005996, GO:0006793, GO:0006796 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.07 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Aldolase_II | PF00596.28 | 1.3e-50 | 11–186 | Class II Aldolase and Adducin N-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: serA2 (D-3-phosphoglycerate dehydrogenase SerA), high confidence from genomic context alone (score 964 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0728c serA2 |
D-3-phosphoglycerate dehydrogenase SerA | 965 | 964 ctx | neighborhood:882 coexpression:608 |
Rv1438 tpi |
triosephosphate isomerase | 941 | 923 | database:900 |
Rv0729 xylB |
D-xylulose kinase XylB | 936 | 916 ctx | neighborhood:790 coexpression:445 |
Rv0363c fba |
fructose-bisphosphate aldolase | 924 | 909 | database:900 |
Rv2498c citE |
citrate (pro-3S)-lyase subunit beta | 731 | 732 | coexpression:732 |
Rv3075c hyp |
hypothetical protein | 730 | 730 | coexpression:730 |
Rv0730 |
GCN5-like N-acetyltransferase | 619 | 603 ctx | neighborhood:601 |
Rv1972 |
Mce associated membrane protein | 540 | 519 | database:445 |
Rv1973 |
Mce associated membrane protein | 539 | 518 | database:445 |
Rv0178 |
Mce associated membrane protein | 536 | 515 | database:445 |
Rv3492c |
Mce associated protein | 535 | 514 | database:445 |
Rv1363c |
membrane protein | 535 | 514 | database:445 |
Rv1362c |
membrane protein | 535 | 514 | database:445 |
Rv0177 |
Mce associated protein | 534 | 512 | database:445 |
Rv0200 |
transmembrane protein | 534 | 512 | database:445 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: L-fuculose phosphate aldolase FucA
- MTBC0 PGAP product: L-fuculose-phosphate aldolase
- Pfam (hmmscan --cut_ga): Aldolase_II PF00596.28 (E=1e-50)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215241.1)
- Domains: Pfam-A via hmmscan --cut_ga — Aldolase_II (PF00596.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0235 - Curated reference: UniProt P95075 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
serA2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000769|Rv0727c|fucA MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL