Rv0518 Family assigned · medium auto-curated
H37Rv Rv0518 · MTBC0 mtbc0_000546 ·
231 aa · 613645–614340 (+) ·
RefSeq NP_215032.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | SGNH/GDSL hydrolase family protein |
| Revised (this work) | SGNH/GDSL hydrolase family protein. Pfam: Lipase_GDSL (PF00657.29), Lipase_GDSL_2 (PF13472.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O33363
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GDSL lipase Rv0518 |
| EC (curated) |
EC 3.1.1.-
|
| Curated function | GDSL lipase that catalyzes the hydrolysis of p-nitrophenyl (pNP) esters. pNP-decanoate (C10) is the preferred substrate. It can also use pNP-octanoate (C8), pNP-dodecanoate (C12) and pNP-tetradecanoate (C14). Has lower activity with pNP-butyrate (C4), pNP-palmitate (C16) and pNP-stearate (C18). Does not show phospholipase A1 activity. Might help bacteria to utilize available lipids for its growth as well as provide resistance to various intracellular stresses by cell wall modulation resulting in enhanced intracellular survival. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| eggNOG description | GDSL-like Lipase/Acylhydrolase family |
| Orthologous group | COG2755 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.119 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Lipase_GDSL | PF00657.29 | 3.0e-09 | 40–221 | GDSL-like Lipase/Acylhydrolase |
Lipase_GDSL_2 | PF13472.13 | 6.7e-19 | 42–215 | GDSL-like Lipase/Acylhydrolase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0517 (acyltransferase), high confidence from genomic context alone (score 909 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0517 |
acyltransferase | 912 | 909 ctx | neighborhood:757 cooccurence:640 |
Rv3810 pirG |
cell surface protein | 740 | 733 ctx | cooccurence:731 |
Rv3707c hyp |
hypothetical protein | 717 | 718 ctx | cooccurence:716 |
Rv0273c |
transcriptional regulator | 669 | 669 ctx | cooccurence:669 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 662 | 662 ctx | cooccurence:662 |
Rv3906c hyp |
hypothetical protein | 623 | 624 ctx | cooccurence:538 |
Rv3593 lpqF |
lipoprotein LpqF | 621 | 621 ctx | cooccurence:620 |
Rv1836c hyp |
hypothetical protein | 614 | 613 ctx | cooccurence:610 |
Rv3630 |
integral membrane protein | 625 | 608 ctx | cooccurence:590 |
Rv1987 |
chitinase | 630 | 607 | experimental:405 |
Rv0756c hyp |
hypothetical protein | 618 | 600 | experimental:425 |
Rv3446c hyp |
hypothetical protein | 594 | 594 ctx | cooccurence:592 |
Rv2905 lppW |
lipoprotein LppW | 592 | 593 ctx | cooccurence:588 |
Rv0274 hyp |
hypothetical protein | 586 | 585 ctx | cooccurence:574 |
Rv3035 hyp |
hypothetical protein | 581 | 581 ctx | cooccurence:553 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: SGNH/GDSL hydrolase family protein
- Pfam (hmmscan --cut_ga): Lipase_GDSL PF00657.29 (E=3e-09), Lipase_GDSL_2 PF13472.13 (E=7e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215032.1)
- Domains: Pfam-A via hmmscan --cut_ga — Lipase_GDSL (PF00657.29), Lipase_GDSL_2 (PF13472.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2755 - Curated reference: UniProt O33363 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
62 functional partner(s); context anchor
Rv0517 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000546|Rv0518| MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGDSYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTARAVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTADVPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIAPLISMELVG