Rv0518 Family assigned · medium auto-curated

H37Rv Rv0518 · MTBC0 mtbc0_000546 · 231 aa · 613645–614340 (+) · RefSeq NP_215032.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSGNH/GDSL hydrolase family protein
Revised (this work)SGNH/GDSL hydrolase family protein. Pfam: Lipase_GDSL (PF00657.29), Lipase_GDSL_2 (PF13472.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33363 SwissProt · reviewed · Evidence at protein level
UniProt nameGDSL lipase Rv0518
EC (curated) EC 3.1.1.-
Curated functionGDSL lipase that catalyzes the hydrolysis of p-nitrophenyl (pNP) esters. pNP-decanoate (C10) is the preferred substrate. It can also use pNP-octanoate (C8), pNP-dodecanoate (C12) and pNP-tetradecanoate (C14). Has lower activity with pNP-butyrate (C4), pNP-palmitate (C16) and pNP-stearate (C18). Does not show phospholipase A1 activity. Might help bacteria to utilize available lipids for its growth as well as provide resistance to various intracellular stresses by cell wall modulation resulting in enhanced intracellular survival.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionGDSL-like Lipase/Acylhydrolase family
Orthologous groupCOG2755

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.119 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lipase_GDSLPF00657.29 3.0e-0940–221 GDSL-like Lipase/Acylhydrolase
Lipase_GDSL_2PF13472.13 6.7e-1942–215 GDSL-like Lipase/Acylhydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0517 (acyltransferase), high confidence from genomic context alone (score 909 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0517 acyltransferase 912 909 ctx neighborhood:757 cooccurence:640
Rv3810 pirG cell surface protein 740 733 ctx cooccurence:731
Rv3707c hyp hypothetical protein 717 718 ctx cooccurence:716
Rv0273c transcriptional regulator 669 669 ctx cooccurence:669
Rv0290 eccD3 ESX-3 secretion system protein EccD 662 662 ctx cooccurence:662
Rv3906c hyp hypothetical protein 623 624 ctx cooccurence:538
Rv3593 lpqF lipoprotein LpqF 621 621 ctx cooccurence:620
Rv1836c hyp hypothetical protein 614 613 ctx cooccurence:610
Rv3630 integral membrane protein 625 608 ctx cooccurence:590
Rv1987 chitinase 630 607 experimental:405
Rv0756c hyp hypothetical protein 618 600 experimental:425
Rv3446c hyp hypothetical protein 594 594 ctx cooccurence:592
Rv2905 lppW lipoprotein LppW 592 593 ctx cooccurence:588
Rv0274 hyp hypothetical protein 586 585 ctx cooccurence:574
Rv3035 hyp hypothetical protein 581 581 ctx cooccurence:553

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SGNH/GDSL hydrolase family protein
  • Pfam (hmmscan --cut_ga): Lipase_GDSL PF00657.29 (E=3e-09), Lipase_GDSL_2 PF13472.13 (E=7e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215032.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lipase_GDSL (PF00657.29), Lipase_GDSL_2 (PF13472.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2755
  • Curated reference: UniProt O33363 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 62 functional partner(s); context anchor Rv0517
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000546|Rv0518|
MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGDSYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTARAVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTADVPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIAPLISMELVG