Rv3906c Resolved · medium auto-curated

H37Rv Rv3906c · MTBC0 mtbc0_004140 · 169 aa · 4415349–4415858 (-) · RefSeq NP_218423.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpullulanase
Revised (this work)Pullulanase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05439 TrEMBL · unreviewed · Predicted
UniProt namePullulanase

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ETCM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.967 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pcnA (poly(A) polymerase PcnA), high confidence from genomic context alone (score 851 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3907c pcnA poly(A) polymerase PcnA 851 851 ctx neighborhood:849
Rv3910 murJ peptidoglycan biosynthesis protein 830 830 ctx neighborhood:618 cooccurence:569
Rv3909 hyp hypothetical protein 811 804 ctx neighborhood:669
Rv0383c ttfA hyp hypothetical protein 741 741 ctx cooccurence:741
Rv1125 hyp hypothetical protein 724 724 ctx cooccurence:723
Rv0513 transmembrane protein 721 721 ctx cooccurence:717
Rv2719c chiZ membrane protein 715 715 ctx cooccurence:712
Rv1836c hyp hypothetical protein 714 715 ctx cooccurence:709
Rv0756c hyp hypothetical protein 714 713 ctx cooccurence:708
Rv2743c hyp hypothetical protein 700 701 ctx cooccurence:699
Rv3810 pirG cell surface protein 690 691 ctx cooccurence:683
Rv3707c hyp hypothetical protein 690 691 ctx cooccurence:689
Rv0138 hyp hypothetical protein 688 689 ctx cooccurence:688
Rv0475 hbhA heparin binding hemagglutinin HbhA 688 689 ctx cooccurence:687
Rv2905 lppW lipoprotein LppW 684 685 ctx cooccurence:666

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: pullulanase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218423.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ETCM
  • Curated reference: UniProt O05439 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s); context anchor pcnA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004140|Rv3906c|
MEYCIAGDDGSAGIWNRPFDVDLDGDGRLDAIGLDLDGDGLRDDALADFDGDDVADHAVFDVDNDGTPESYFIDDGSGTWAVAVDRGGQLRWYGLDGVEHTGGPLVDFDGFGGLDDRLLDTDGDGLADRVLCAGEQRVTGYVDTDGDGRWDVRLTDTDGDGTADGASSL