Rv0514 Still unknown · low auto-curated

H37Rv Rv0514 · MTBC0 mtbc0_000542 · 99 aa · 609606–609905 (+) · RefSeq NP_215028.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33359 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B01S

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.609 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hemB (delta-aminolevulinic acid dehydratase), high confidence from genomic context alone (score 977 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0512 hemB delta-aminolevulinic acid dehydratase 977 977 ctx neighborhood:869 coexpression:833
Rv0513 transmembrane protein 966 967 ctx neighborhood:881 coexpression:732
Rv0511 hemD uroporphyrin-III C-methyltransferase 953 954 ctx neighborhood:773 coexpression:805
Rv0510 hemC porphobilinogen deaminase 811 812 ctx neighborhood:744
Rv0528 transmembrane protein 761 761 coexpression:761
Rv0509 hemA glutamyl-tRNA reductase 756 756 ctx neighborhood:741
Rv2552c aroE shikimate 5-dehydrogenase 748 748 coexpression:748
Rv2902c rnhB ribonuclease HII 731 731 coexpression:731
Rv0508 hyp hypothetical protein 660 660 ctx neighborhood:655
Rv0515 hyp hypothetical protein 550 550 ctx neighborhood:535
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 493 494 coexpression:494
Rv1713 engA GTPase Der 449 449 coexpression:449
Rv1712 cmk cytidylate kinase 441 441 coexpression:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215028.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B01S
  • Curated reference: UniProt O33359 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor hemB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000542|Rv0514|
MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH