Rv0514 Still unknown · low auto-curated
H37Rv Rv0514 · MTBC0 mtbc0_000542 ·
99 aa · 609606–609905 (+) ·
RefSeq NP_215028.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O33359
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2B01S |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.609 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hemB (delta-aminolevulinic acid dehydratase), high confidence from genomic context alone (score 977 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0512 hemB |
delta-aminolevulinic acid dehydratase | 977 | 977 ctx | neighborhood:869 coexpression:833 |
Rv0513 |
transmembrane protein | 966 | 967 ctx | neighborhood:881 coexpression:732 |
Rv0511 hemD |
uroporphyrin-III C-methyltransferase | 953 | 954 ctx | neighborhood:773 coexpression:805 |
Rv0510 hemC |
porphobilinogen deaminase | 811 | 812 ctx | neighborhood:744 |
Rv0528 |
transmembrane protein | 761 | 761 | coexpression:761 |
Rv0509 hemA |
glutamyl-tRNA reductase | 756 | 756 ctx | neighborhood:741 |
Rv2552c aroE |
shikimate 5-dehydrogenase | 748 | 748 | coexpression:748 |
Rv2902c rnhB |
ribonuclease HII | 731 | 731 | coexpression:731 |
Rv0508 hyp |
hypothetical protein | 660 | 660 ctx | neighborhood:655 |
Rv0515 hyp |
hypothetical protein | 550 | 550 ctx | neighborhood:535 |
Rv0527 ccdA |
cytochrome C-type biogenesis protein CcdA | 493 | 494 | coexpression:494 |
Rv1713 engA |
GTPase Der | 449 | 449 | coexpression:449 |
Rv1712 cmk |
cytidylate kinase | 441 | 441 | coexpression:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215028.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B01S - Curated reference: UniProt O33359 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
hemB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000542|Rv0514| MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH