hemA Resolved · high auto-curated

H37Rv Rv0509 · MTBC0 mtbc0_000537 · 468 aa · 603898–605304 (+) · RefSeq NP_215023.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamyl-tRNA reductase
MTBC0 PGAP re-annotationglutamyl-tRNA reductase
Revised (this work)Glutamyl-tRNA reductase. Pfam: GlutR_N (PF05201.21), Shikimate_DH (PF01488.27), GlutR_dimer (PF00745.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMP7 SwissProt · reviewed · Evidence at protein level
UniProt nameGlutamyl-tRNA reductase
EC (curated) EC 1.2.1.70
Curated functionCatalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namehemA
eggNOG descriptionCatalyzes the NADPH-dependent reduction of glutamyl- tRNA(Glu) to glutamate 1-semialdehyde (GSA)
Orthologous groupCOG0373
EC number EC 1.2.1.70
KEGG orthology K02492
KEGG pathways map00860, map01100, map01110, map01120
KEGG modules M00121
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.275 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlutR_NPF05201.21 8.6e-507–156 Glutamyl-tRNAGlu reductase, N-terminal domain
Shikimate_DHPF01488.27 7.6e-30172–314 Shikimate / quinate 5-dehydrogenase
GlutR_dimerPF00745.26 4.7e-25328–426 Glutamyl-tRNAGlu reductase, dimerisation domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hemC (porphobilinogen deaminase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0510 hemC porphobilinogen deaminase 999 998 ctx neighborhood:876 fusion:742 cooccurence:768 coexpression:720 textmining:856
Rv0524 hemL glutamate-1-semialdehyde 2,1-aminomutase 996 988 ctx cooccurence:771 database:900 textmining:706
Rv0511 hemD uroporphyrin-III C-methyltransferase 992 979 ctx neighborhood:829 cooccurence:736 coexpression:563 textmining:669
Rv0512 hemB delta-aminolevulinic acid dehydratase 984 953 ctx neighborhood:748 cooccurence:763 textmining:693
Rv2992c gltS glutamate--tRNA ligase 967 901 database:900 textmining:686
Rv0508 hyp hypothetical protein 818 812 ctx neighborhood:811
Rv0513 transmembrane protein 788 788 ctx neighborhood:741
Rv0514 transmembrane protein 756 756 ctx neighborhood:741
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 863 739 ctx cooccurence:636 textmining:497
Rv0529 ccsA cytochrome C-type biogenesis protein CcsA 753 655 coexpression:434
Rv0506 mmpS2 membrane protein MmpS2 638 637 ctx neighborhood:637
Rv0507 mmpL2 transmembrane transport protein MmpL2 637 637 ctx neighborhood:637
Rv2678c hemE uroporphyrinogen decarboxylase 853 617 ctx cooccurence:446 textmining:633
Rv2677c hemY protoporphyrinogen oxidase 737 576 ctx cooccurence:449 textmining:405
Rv0505c serB1 phosphoserine phosphatase SerB 534 534 ctx neighborhood:531

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamyl-tRNA reductase
  • MTBC0 PGAP product: glutamyl-tRNA reductase
  • Pfam (hmmscan --cut_ga): GlutR_N PF05201.21 (E=9e-50), Shikimate_DH PF01488.27 (E=8e-30), GlutR_dimer PF00745.26 (E=5e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215023.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GlutR_N (PF05201.21), Shikimate_DH (PF01488.27), GlutR_dimer (PF00745.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0373
  • Curated reference: UniProt P9WMP7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor hemC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000537|Rv0509|hemA
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN