Rv0274 Family assigned · medium
H37Rv Rv0274 · MTBC0 mtbc0_000291 ·
193 aa · 330804–331385 (+) ·
RefSeq NP_214788.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | VOC family protein |
| Revised (this work) | VOC (vicinal-oxygen-chelate) / glyoxalase-bleomycin-resistance superfamily protein (Pfam Glyoxalase PF00903). Putative metalloenzyme (glyoxalase / dioxygenase-type chemistry); specific substrate not established. |
Curated reference (UniProt)
| UniProt |
O53680
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| eggNOG description | glyoxalase bleomycin resistance protein |
| Orthologous group | COG0346 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.624 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.60% of strains (874) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glyoxalase | PF00903.32 | 5.0e-21 | 15–163 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
Glyoxalase_4 | PF13669.13 | 6.6e-07 | 17–125 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0273c (transcriptional regulator), high confidence from genomic context alone (score 900 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0273c |
transcriptional regulator | 900 | 900 ctx | neighborhood:773 cooccurence:575 |
Rv0272c hyp |
hypothetical protein | 898 | 898 ctx | neighborhood:598 cooccurence:753 |
Rv0271c fadE6 |
acyl-CoA dehydrogenase FadE6 | 685 | 673 ctx | neighborhood:544 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 676 | 656 | coexpression:645 |
Rv0518 hyp |
hypothetical protein | 586 | 585 ctx | cooccurence:574 |
Rv3368c |
oxidoreductase | 563 | 554 | coexpression:415 |
Rv2032 acg |
NAD(P)H nitroreductase | 538 | 528 | coexpression:420 |
Rv3127 hyp |
hypothetical protein | 537 | 526 | coexpression:419 |
Rv0311 hyp |
hypothetical protein | 523 | 523 ctx | cooccurence:514 |
Rv0767c |
HTH-type transcriptional regulator | 519 | 520 ctx | cooccurence:519 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 530 | 511 | coexpression:497 |
Rv3316 sdhC |
succinate dehydrogenase cytochrome B-556 subunit | 529 | 508 | coexpression:505 |
Rv3131 |
NAD(P)H nitroreductase | 509 | 499 | coexpression:418 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 444 | 433 | coexpression:431 |
Rv3593 lpqF |
lipoprotein LpqF | 453 | 432 ctx | cooccurence:427 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'VOC family protein'
- Pfam: Glyoxalase PF00903 (E=5.0e-21), Glyoxalase_4 PF13669 (E=6.6e-07)
ESM Atlas signal (exploratory)
Ancestral protein hash c4591f310352618625ff9aa51466afe3 ·
10 ESM-space neighbours (max similarity 0.888).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 10352 |
1.01 | Cupin/VOC beta-barrel core |
| 2 | 13144 |
0.94 | VOC/glyoxalase fold metal-binding core |
| 3 | 6430 |
0.93 | VOC/cupin metalloenzyme signature |
| 4 | 12978 |
0.93 | Metal-coordinating catalytic beta-strands |
| 5 | 2557 |
0.91 | VOC 2-His/acidic facial triad |
| 6 | 377 |
0.80 | N-terminal VOC metal-ligating strand |
| 7 | 9959 |
0.79 | VOC metalloenzyme fold detector |
| 8 | 9897 |
0.73 | VOC fold metal-binding core |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214788.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase (PF00903.32), Glyoxalase_4 (PF13669.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0346 - Curated reference: UniProt O53680 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
37 functional partner(s); context anchor
Rv0273c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000291|Rv0274| MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR