Rv0523c Family assigned · low auto-curated

H37Rv Rv0523c · MTBC0 mtbc0_000551 · 131 aa · 617783–618178 (-) · RefSeq NP_215037.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnitroreductase family deazaflavin-dependent oxidoreductase
Revised (this work)Nitroreductase family deazaflavin-dependent oxidoreductase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06389 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2C2H7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hemL (glutamate-1-semialdehyde 2,1-aminomutase), medium confidence from genomic context alone (score 595 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0524 hemL glutamate-1-semialdehyde 2,1-aminomutase 594 595 ctx neighborhood:593
Rv0525 hyp hypothetical protein 594 594 ctx neighborhood:593
Rv0756c hyp hypothetical protein 592 593 ctx cooccurence:590
Rv2560 hyp hypothetical protein 562 562 ctx cooccurence:557
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 531 531 ctx neighborhood:531
Rv0526 thioredoxin 531 531 ctx neighborhood:531
Rv2923c hyp hypothetical protein 513 514 ctx cooccurence:508
Rv0676c mmpL5 transmembrane transport protein MmpL5 504 505 ctx cooccurence:504
Rv0402c mmpL1 transmembrane transport protein MmpL1 489 490 ctx cooccurence:489
Rv0466 hyp hypothetical protein 487 488 ctx cooccurence:486
Rv2339 mmpL9 transmembrane transport protein MmpL9 474 474 ctx cooccurence:471
Rv0507 mmpL2 transmembrane transport protein MmpL2 465 466 ctx cooccurence:464
Rv1219c raaS transcriptional regulator 455 455 ctx cooccurence:452
Rv0528 transmembrane protein 453 453 ctx neighborhood:451
Rv0529 ccsA cytochrome C-type biogenesis protein CcsA 453 453 ctx neighborhood:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nitroreductase family deazaflavin-dependent oxidoreductase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215037.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C2H7
  • Curated reference: UniProt O06389 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor hemL
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000551|Rv0523c|
MQLPQWLARFNRYVTNPIQRLWAGWLPAFAILEHVGRRSGKPYRTPLNVFSADVDGRAGVAILLTYGPNRDWLKNITAAGGGRMRRYGKTFGVANPRRLTKAEAAPYVSSRWRPVFARLPFDEAVLLTKAD