Rv0531 Still unknown · low auto-curated
H37Rv Rv0531 · MTBC0 mtbc0_000560 ·
105 aa · 625786–626103 (+) ·
RefSeq NP_215045.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4229 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF4229. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06397
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible conserved membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF4229) |
| Orthologous group | 2CG79 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.211 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4229 | PF14012.12 | 5.1e-21 | 17–85 | Protein of unknown function (DUF4229) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3668c (protease), high confidence from genomic context alone (score 765 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3668c |
protease | 765 | 765 ctx | cooccurence:764 |
Rv1275 lprC |
lipoprotein LprC | 738 | 739 ctx | cooccurence:737 |
Rv1274 lprB |
lipoprotein LprB | 735 | 735 ctx | cooccurence:734 |
Rv3346c |
transmembrane protein | 732 | 733 ctx | cooccurence:732 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 720 | 721 ctx | cooccurence:719 |
Rv2525c hyp |
hypothetical protein | 707 | 708 ctx | cooccurence:706 |
Rv0358 hyp |
hypothetical protein | 696 | 697 ctx | cooccurence:695 |
Rv3802c |
membrane protein | 691 | 692 ctx | cooccurence:690 |
Rv1100 hyp |
hypothetical protein | 681 | 681 ctx | cooccurence:680 |
Rv3217c |
integral membrane protein | 672 | 673 ctx | cooccurence:671 |
Rv0530A hyp |
hypothetical protein | 668 | 668 ctx | neighborhood:645 |
Rv3244c lpqB |
lipoprotein LpqB | 653 | 653 ctx | cooccurence:652 |
Rv3755c hyp |
hypothetical protein | 638 | 638 ctx | cooccurence:637 |
Rv0207c hyp |
hypothetical protein | 634 | 634 ctx | cooccurence:632 |
Rv1476 |
membrane protein | 632 | 632 ctx | cooccurence:632 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: DUF4229 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4229 PF14012.12 (E=5e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215045.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4229 (PF14012.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2CG79 - Curated reference: UniProt O06397 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
62 functional partner(s); context anchor
Rv3668c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000560|Rv0531| MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTEFPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEEQ