Rv0531 Still unknown · low auto-curated

H37Rv Rv0531 · MTBC0 mtbc0_000560 · 105 aa · 625786–626103 (+) · RefSeq NP_215045.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF4229 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4229. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06397 TrEMBL · unreviewed · Predicted
UniProt namePossible conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF4229)
Orthologous group2CG79

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.211 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4229PF14012.12 5.1e-2117–85 Protein of unknown function (DUF4229)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3668c (protease), high confidence from genomic context alone (score 765 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3668c protease 765 765 ctx cooccurence:764
Rv1275 lprC lipoprotein LprC 738 739 ctx cooccurence:737
Rv1274 lprB lipoprotein LprB 735 735 ctx cooccurence:734
Rv3346c transmembrane protein 732 733 ctx cooccurence:732
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 720 721 ctx cooccurence:719
Rv2525c hyp hypothetical protein 707 708 ctx cooccurence:706
Rv0358 hyp hypothetical protein 696 697 ctx cooccurence:695
Rv3802c membrane protein 691 692 ctx cooccurence:690
Rv1100 hyp hypothetical protein 681 681 ctx cooccurence:680
Rv3217c integral membrane protein 672 673 ctx cooccurence:671
Rv0530A hyp hypothetical protein 668 668 ctx neighborhood:645
Rv3244c lpqB lipoprotein LpqB 653 653 ctx cooccurence:652
Rv3755c hyp hypothetical protein 638 638 ctx cooccurence:637
Rv0207c hyp hypothetical protein 634 634 ctx cooccurence:632
Rv1476 membrane protein 632 632 ctx cooccurence:632

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF4229 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF4229 PF14012.12 (E=5e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215045.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4229 (PF14012.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CG79
  • Curated reference: UniProt O06397 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 62 functional partner(s); context anchor Rv3668c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000560|Rv0531|
MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTEFPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEEQ