lpqF Resolved · high auto-curated

H37Rv Rv3593 · MTBC0 mtbc0_003812 · 452 aa · 4058029–4059387 (+) · RefSeq NP_218110.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqF
MTBC0 PGAP re-annotationserine hydrolase
Revised (this work)Serine hydrolase. Pfam: ORF_12_N (PF18042.8), Beta-lactamase2 (PF13354.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06155 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved lipoprotein LpqF

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namelpqF
eggNOG descriptionBeta-lactamase class A
Orthologous groupCOG2367

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.398 · purifying
Polymorphic sites (≥ 0.1% of strains) 11 synonymous, 13 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ORF_12_NPF18042.8 1.9e-1851–138 ORF 12 gene product N-terminal
Beta-lactamase2PF13354.13 3.5e-24154–284 Beta-lactamase enzyme family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mhuD (heme-degrading monooxygenase), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3592 mhuD heme-degrading monooxygenase 984 884 ctx neighborhood:881 textmining:870
Rv3591c hydrolase 790 791 ctx neighborhood:791
Rv3810 pirG cell surface protein 760 761 ctx cooccurence:757
Rv3707c hyp hypothetical protein 753 754 ctx cooccurence:750
Rv2743c hyp hypothetical protein 742 742 ctx cooccurence:740
Rv0290 eccD3 ESX-3 secretion system protein EccD 737 738 ctx cooccurence:736
Rv0817c lmeA hyp hypothetical protein 716 717 ctx cooccurence:716
Rv0479c membrane protein 670 670 ctx cooccurence:660
Rv0416 thiS sulfur carrier protein ThiS 667 667 ctx cooccurence:666
Rv0518 hyp hypothetical protein 621 621 ctx cooccurence:620
Rv1275 lprC lipoprotein LprC 606 607 ctx cooccurence:591
Rv0320 hyp hypothetical protein 604 604 ctx cooccurence:603
Rv1836c hyp hypothetical protein 564 564 ctx cooccurence:535
Rv3594 hyp hypothetical protein 578 563 ctx neighborhood:495
Rv3244c lpqB lipoprotein LpqB 561 562 ctx cooccurence:548

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqF
  • MTBC0 PGAP product: serine hydrolase
  • Pfam (hmmscan --cut_ga): ORF_12_N PF18042.8 (E=2e-18), Beta-lactamase2 PF13354.13 (E=3e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218110.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ORF_12_N (PF18042.8), Beta-lactamase2 (PF13354.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2367
  • Curated reference: UniProt O06155 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor mhuD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003812|Rv3593|lpqF
MGPARLHNRRAGRRMLALSAAAALIVALASGCSSAPTPSANAANHGHRIDTRTPPGLRAQQTMDMLNSDWPIGEIGVGTLAAPGQVDTVKTTMEALWWDRPFALAGVDIGASVAALHLISSYGAQQDIRIHTDDDGWVDRFDVETQAPSIASWRDVDAVLSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLASIFKLYVLHALAGAVQHNTVSWDDLLTVTAKSKAVGSSGLELPVGARVSVRTAAEKMIATSDNMATDLLIERLGTRAIEEALASAGHHDPASMTPFPTMYELFSVGWGKPDLRDQWKHATQQVRAQILRQTNSTPYQPDPTRAHTPASNYGAEWYGSAEDICRVHAALRADAVGPASPVRQIMSAVPGIQLDRSVWPYIGAKAGGLPGDLTFSWYAVDKTGQPWVVSFQLNWPRDHGPTVTGWMLQVARQVFALIAPQ