Rv0530 Family assigned · medium auto-curated
H37Rv Rv0530 · MTBC0 mtbc0_000558 ·
405 aa · 624364–625581 (+) ·
RefSeq NP_215044.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | MinD/ParA family protein |
| Revised (this work) | MinD/ParA family protein. Pfam: CbiA (PF01656.30), AAA_31 (PF13614.13), CBP_BcsQ (PF06564.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06396
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| eggNOG description | Cellulose biosynthesis protein BcsQ |
| Orthologous group | COG0455 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.441 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CbiA | PF01656.30 | 4.7e-11 | 153–363 | CobQ/CobB/MinD/ParA nucleotide binding domain |
AAA_31 | PF13614.13 | 4.4e-07 | 153–301 | AAA domain |
CBP_BcsQ | PF06564.19 | 2.0e-04 | 153–191 | Cellulose biosynthesis protein BcsQ |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ccsA (cytochrome C-type biogenesis protein CcsA), high confidence from genomic context alone (score 751 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0529 ccsA |
cytochrome C-type biogenesis protein CcsA | 751 | 751 ctx | neighborhood:736 |
Rv0528 |
transmembrane protein | 732 | 732 ctx | neighborhood:691 |
Rv0526 |
thioredoxin | 710 | 710 ctx | neighborhood:667 |
Rv0527 ccdA |
cytochrome C-type biogenesis protein CcdA | 612 | 613 ctx | neighborhood:609 |
Rv0525 hyp |
hypothetical protein | 593 | 593 ctx | neighborhood:587 |
Rv0524 hemL |
glutamate-1-semialdehyde 2,1-aminomutase | 590 | 591 ctx | neighborhood:580 |
Rv0531 |
membrane protein | 576 | 561 ctx | neighborhood:544 |
Rv3286c sigF |
RNA polymerase sigma factor SigF | 471 | 439 | coexpression:420 |
Rv0883c sepH hyp |
hypothetical protein | 433 | 434 ctx | cooccurence:430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: MinD/ParA family protein
- Pfam (hmmscan --cut_ga): CbiA PF01656.30 (E=5e-11), AAA_31 PF13614.13 (E=4e-07), CBP_BcsQ PF06564.19 (E=2e-04)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215044.1)
- Domains: Pfam-A via hmmscan --cut_ga — CbiA (PF01656.30), AAA_31 (PF13614.13), CBP_BcsQ (PF06564.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0455 - Curated reference: UniProt O06396 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
9 functional partner(s); context anchor
ccsA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000558|Rv0530| MLVTEHPRTGVGAPDSGNGGTDHPTVQLPPVPSVGAPPAAAGGETPTRSVAGFRTQRLDPTAYGAYYSGPDEGPASPAERPPYRLEPVPHTPYPELATTTLLRPVKPPPSEGWRRLLYLLSGRLINAGEGPRAAHLNDLVAQVNRPLRGCYRIAVLSLKGGVGKTTITATLGATFADLRGDRVVAVDANPDRGTLSQKVPLETPATVRHLLRDADGIERYSDVRGYTSKGPSGLEVLASDSDPASSDAFSADDYTRTLDILERFYGLVLTDCGTGLLHSAMSAVLPRSDVLVVVSSGSIDGARSAAATLDWLQAHGHDDQVRNSIAVVNAVRPRAGKVDVGKVVEHFSRRCRAVRVVPFDPHLEEGAEIALDRLRRETREALTELAAVVAAGFPGDPRRCKPSFT