Rv3035 Family assigned · medium auto-curated

H37Rv Rv3035 · MTBC0 - · 360 aa · 3395379–3396461 (+) · RefSeq NP_217551.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains PQQ_2 (PF13360.14) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6XFZ8 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein Rv3035

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPyrrolo-quinoline quinone
Orthologous groupCOG1520

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.228 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PQQ_2PF13360.14 9.4e-07189–333 Outer membrane protein assembly factor BamB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprC (lipoprotein LprC), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1275 lprC lipoprotein LprC 774 774 ctx cooccurence:770
Rv1274 lprB lipoprotein LprB 773 774 ctx cooccurence:771
Rv1476 membrane protein 772 772 ctx cooccurence:771
Rv3802c membrane protein 770 771 ctx cooccurence:767
Rv3792 aftA arabinofuranosyltransferase 769 769 ctx cooccurence:766
Rv1125 hyp hypothetical protein 767 767 ctx cooccurence:766
Rv3668c protease 763 763 ctx cooccurence:761
Rv0383c ttfA hyp hypothetical protein 770 761 ctx cooccurence:761
Rv0466 hyp hypothetical protein 761 761 ctx cooccurence:760
Rv2876 transmembrane protein 759 759 ctx cooccurence:757
Rv3244c lpqB lipoprotein LpqB 757 757 ctx cooccurence:752
Rv2672 protease 756 757 ctx cooccurence:745
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 764 756 ctx cooccurence:753
Rv3346c transmembrane protein 755 755 ctx cooccurence:754
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 752 753 ctx cooccurence:751

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): PQQ_2 PF13360.14 (E=9e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217551.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PQQ_2 (PF13360.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1520
  • Curated reference: UniProt I6XFZ8 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 134 functional partner(s); context anchor lprC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3035|
MAAGPALSARGYLALNGQTPAGCSLMEWQNDNNGRQRWCVRLVQGGGFAGPLFDGFDNLYVGQPGAIISFPPTQWTRWRQPVIGMPSTPRFLGHGRLLVSTHLGQLLVFDTRRGMVVGSPVDLVDGIDPTDATRGLADCAPARPGCPVAAAPAFSSVNGTVVVSVWQPGEPAAKLVGLKYHAEQLVREWTSDAVSAGVLASPVLSADGSTVYVNGRDHRLWALNAADGKAKWSAPLGFLAQTPPALTPHGLIVSGGGPDTALAAFRDAGDHAEGAWRRDDVTALSTASLAGTGVGYTVISGPNHDGTPGLSLLVFDPANGHTVNSYPLPGATGYPVGVSVGNDRRVVTATSDGQVYSFAP