mymT Resolved · medium auto-curated

H37Rv Rv0186A · MTBC0 - · 53 aa · 218390–218551 (-) · RefSeq YP_004837046.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)metallothionein
MTBC0 PGAP re-annotation
Revised (this work)Metallothionein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WK09 SwissProt · reviewed · Evidence at protein level
UniProt nameMetallothionein
Curated functionMetallothioneins are small proteins that have a high content of cysteine residues which allow them to bind heavy metal ions through clusters of thiolate bonds. MymT binds up to seven ions of Cu(+), with a preference for four to six Cu(+) ions, in a solvent-shielded core. MymT protects M.tuberculosis from copper toxicity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B11Q
KEGG orthology K21609
Gene Ontology (28) GO:0003674, GO:0005488, GO:0005507, GO:0008150, GO:0008270, GO:0010035, GO:0010038, GO:0010043, GO:0010045, GO:0032025, GO:0042221, GO:0042592 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0187 (O-methyltransferase), medium confidence from genomic context alone (score 649 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0187 O-methyltransferase 648 649 ctx neighborhood:649
Rv0188 transmembrane protein 535 358
Rv0190 ricR hyp hypothetical protein 870 41 textmining:870
Rv0847 lpqS lipoprotein LpqS 870 41 textmining:870
Rv2963 integral membrane protein 870 41 textmining:870
Rv0846c mmcO oxidase 870 41 textmining:870
Rv0967 csoR copper-sensing transcriptional repressor CsoR 804 41 textmining:804
Rv0969 ctpV copper-exporting ATPase 655 41 textmining:655
Rv2683 hyp hypothetical protein 583 41 textmining:583
Rv0850 Rv0850, (MTV043.43), len: 110 aa. Putative transposase (fragment), similar in part to others e.g. Q45144|Q4514 transposable element IS31831 582 41 textmining:582
Rv0848 cysK2 cysteine synthase CysK 546 41 textmining:546
Rv0849 MFS-type transporter 532 41 textmining:532
Rv2641 cadI cadmium inducible protein CadI 511 41 textmining:511
Rv0970 integral membrane protein 510 41 textmining:510
Rv1946c lppG lipoprotein 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): metallothionein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837046.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B11Q
  • Curated reference: UniProt P9WK09 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor Rv0187
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0186A|mymT
MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK