mymT Resolved · medium auto-curated
H37Rv Rv0186A · MTBC0 - ·
53 aa · 218390–218551 (-) ·
RefSeq YP_004837046.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | metallothionein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Metallothionein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WK09
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Metallothionein |
| Curated function | Metallothioneins are small proteins that have a high content of cysteine residues which allow them to bind heavy metal ions through clusters of thiolate bonds. MymT binds up to seven ions of Cu(+), with a preference for four to six Cu(+) ions, in a solvent-shielded core. MymT protects M.tuberculosis from copper toxicity. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2B11Q |
|---|---|
| KEGG orthology |
K21609
|
| Gene Ontology (28) |
GO:0003674, GO:0005488, GO:0005507, GO:0008150, GO:0008270, GO:0010035, GO:0010038, GO:0010043, GO:0010045, GO:0032025, GO:0042221, GO:0042592 +16 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0187 (O-methyltransferase), medium confidence from genomic context alone (score 649 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0187 |
O-methyltransferase | 648 | 649 ctx | neighborhood:649 |
Rv0188 |
transmembrane protein | 535 | 358 | |
Rv0190 ricR hyp |
hypothetical protein | 870 | 41 | textmining:870 |
Rv0847 lpqS |
lipoprotein LpqS | 870 | 41 | textmining:870 |
Rv2963 |
integral membrane protein | 870 | 41 | textmining:870 |
Rv0846c mmcO |
oxidase | 870 | 41 | textmining:870 |
Rv0967 csoR |
copper-sensing transcriptional repressor CsoR | 804 | 41 | textmining:804 |
Rv0969 ctpV |
copper-exporting ATPase | 655 | 41 | textmining:655 |
Rv2683 hyp |
hypothetical protein | 583 | 41 | textmining:583 |
Rv0850 |
Rv0850, (MTV043.43), len: 110 aa. Putative transposase (fragment), similar in part to others e.g. Q45144|Q4514 transposable element IS31831 | 582 | 41 | textmining:582 |
Rv0848 cysK2 |
cysteine synthase CysK | 546 | 41 | textmining:546 |
Rv0849 |
MFS-type transporter | 532 | 41 | textmining:532 |
Rv2641 cadI |
cadmium inducible protein CadI | 511 | 41 | textmining:511 |
Rv0970 |
integral membrane protein | 510 | 41 | textmining:510 |
Rv1946c lppG |
lipoprotein | 510 | 41 | textmining:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): metallothionein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837046.2)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B11Q - Curated reference: UniProt P9WK09 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
Rv0187 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0186A|mymT MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK