Rv3030 Family assigned · medium auto-curated

H37Rv Rv3030 · MTBC0 mtbc0_003221 · 274 aa · 3410411–3411235 (+) · RefSeq NP_217546.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)S-adenosylmethionine-dependent methyltransferase
MTBC0 PGAP re-annotationmethyltransferase domain-containing protein
Revised (this work)Methyltransferase domain-containing protein. Pfam: Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJZ1 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable S-adenosylmethionine-dependent methyltransferase Rv3030
EC (curated) EC 2.1.1.-
Curated functionProbable S-adenosylmethionine-dependent methyltransferase required for the 6-O-methylation of the polysaccharide backbone of 6-O-methylglucosyl lipopolysaccharides (MGLP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
eggNOG descriptionMethyltransferase
Orthologous groupCOG2227
EC number EC 2.1.1.222, EC 2.1.1.64
KEGG orthology K00568
KEGG pathways map00130, map01100, map01110
KEGG modules M00117
Gene Ontology (21) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0008152, GO:0008168, GO:0008757 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.027 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_23PF13489.13 2.0e-1253–197 Methyltransferase domain
Methyltransf_31PF13847.13 1.3e-1164–161 Methyltransferase domain
Methyltransf_25PF13649.13 1.4e-1865–153 Methyltransferase domain
Methyltransf_11PF08241.19 8.5e-2366–156 Methyltransferase domain
Methyltransf_12PF08242.19 1.7e-0966–155 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3031 (1,4-alpha-glucan-branching protein), high confidence from genomic context alone (score 957 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3031 1,4-alpha-glucan-branching protein 991 957 ctx neighborhood:881 cooccurence:553 textmining:809
Rv3032 glycogen synthase 991 936 ctx neighborhood:827 cooccurence:641 textmining:875
Rv3029c fixA electron transfer flavoprotein subunit beta 750 750 ctx neighborhood:748
Rv3038c hyp hypothetical protein 744 742 ctx cooccurence:706
Rv3028c fixB electron transfer flavoprotein subunit alpha 729 729 ctx neighborhood:718
Rv2186c hyp hypothetical protein 707 696 ctx cooccurence:695
Rv3034c acetyltransferase 953 648 ctx cooccurence:635 textmining:873
Rv2418c octT hyp hypothetical protein 925 622 ctx cooccurence:607 textmining:812
Rv3032A hyp hypothetical protein 585 585 ctx neighborhood:585
Rv2695 hyp hypothetical protein 458 459 ctx cooccurence:456
Rv3025c iscS cysteine desulfurase 411 411
Rv1208 gpgS glucosyl-3-phosphoglycerate synthase 919 185 textmining:906
Rv0187 O-methyltransferase 648 103 textmining:624
Rv2419c gpgP glucosyl-3-phosphoglycerate phosphatase 803 54 textmining:801
Rv2417c DegV domain-containing protein 437 49 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: S-adenosylmethionine-dependent methyltransferase
  • MTBC0 PGAP product: methyltransferase domain-containing protein
  • Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=2e-12), Methyltransf_31 PF13847.13 (E=1e-11), Methyltransf_25 PF13649.13 (E=1e-18), Methyltransf_11 PF08241.19 (E=8e-23), Methyltransf_12 PF08242.19 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217546.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2227
  • Curated reference: UniProt P9WJZ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv3031
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003221|Rv3030|
MCAFVPHVPRHSRGDNPPSASTASPAVLTLTGERTIPDLDIENYWFRRHQVVYQRLAPRCTARDVLEAGCGEGYGADLIACVARQVIAVDYDETAVAHVRSRYPRVEVMQANLAELPLPDASVDVVVNFQVIEHLWDQARFVRECARVLRGSGLLMVSTPNRITFSPGRDTPINPFHTRELNADELTSLLIDAGFVDVAMCGLFHGPRLRDMDARHGGSIIDAQIMRAVAGAPWPPELAADVAAVTTADFEMVAAGHDRDIDDSLDLIAIAVRP