tesA Resolved · high auto-curated
H37Rv Rv2928 · MTBC0 mtbc0_003111 ·
261 aa ·
3263195–3263980 MTBC0
(+) ·
RefSeq NP_217444.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thioesterase TesA |
|---|---|
| MTBC0 PGAP re-annotation | thioesterase TesA |
| Revised (this work) | Thioesterase TesA. Pfam: Thioesterase (PF00975.27), Abhydrolase_6 (PF12697.14). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 11 publications
11 TB publications mention this gene. 11 publication(s) discuss this gene (11 in a M. tuberculosis context, 5 in other mycobacteria — M. marinum (3), M. abscessus (2), M. leprae (1)).
| Publication | Date |
|---|---|
| New moonlighting activities for various GroEL/Hsp60 proteins, mainly characterized using recombinant M. tuberculosis GroEL1. doi:10.1016/j.ijbiomac.2025.149266 | 2026 |
| Lipolytic enzymes inhibitors: A new way for antibacterial drugs discovery. doi:10.1016/j.ejmech.2020.112908 | 2021 |
| Methyl arachidonyl fluorophosphonate inhibits Mycobacterium tuberculosis thioesterase TesA and globally affects vancomycin susceptibility. doi:10.1002/1873-3468.13555 | 2020 |
| Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis. doi:10.1016/j.jmb.2018.09.017 | 2018 |
| Oxadiazolone derivatives, new promising multi-target inhibitors against M. tuberculosis. doi:10.1016/j.bioorg.2018.08.025 | 2018 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | Rv2929 (Rv2929, + strand) |
|---|---|
| Overlap | 14 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Lsr2 (lsr2).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.41 (95% CI -0.32 to 4.31). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Probably involved in biosynthesis of phthiocerol dimycocerosate (PDIM) |
|---|---|
| Mycobrowser EC |
3.1.2.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2953
· 100.0% identity |
|---|---|
| M. leprae |
ML2359c
· 74.1% identity |
| M. marinum |
MMAR_1778
· 75.4% identity |
| M. orygis |
RJtmp_003020
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQD5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Thioesterase TesA |
| EC (curated) |
EC 3.1.1.6, EC 3.1.2.-, EC 3.1.2.2
|
| Curated function | Involved in the synthesis of both phthiocerol dimycocerosates (PDIMs) and phenolic glycolipids (PGLs), which are structurally related lipids non-covalently bound to the outer cell wall layer of M.tuberculosis and are important virulence factors. In vitro, TesA has both thioesterase and esterase activities. Exhibits thioesterase activity on acyl-CoA derivatives such as palmitoyl-CoA and decanoyl-CoA. Also displays hydrolytic activity on ester substrates, being more active on pNP esters with short carbon chain lengths (C2-C5) than with those bearing medium and long carbon chain lengths (C8-C18). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | tesA |
| eggNOG description | thioesterase |
| Orthologous group | COG3208 |
| Gene Ontology (47) |
GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009273, GO:0009605, GO:0009607, GO:0009987 +35 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.3 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.89% of strains (1287) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.301 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 40/53 (76%) · mean identity 61.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 40/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 32.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 27 in the ORF — 0 in the essential state, 10 growth-defect, 13 non-essential, 4 growth-advantage. Saturation 0.852, mean read count 43.3913043478. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call high-confidence target
Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Thioesterase TesA. Pfam: Thioesterase (PF00975.27), Abhydrolase_6 (PF12697.14).), which was derived independently from structure and orthology.
| Active / prioritized at | pH 6.6, pH 5.0 (growth condition) |
|---|---|
| Active under hypoxia | yes (non-replicating persistence relevant) |
| Covalent-inhibitor target | EZ120, CyC17, THL (chemically addressable active site) |
experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -4.12 | 0.0 | required |
| fitness in mouse infection (in vivo) | +1.93 | 0.015 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.27 | 0.038 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 435.0 ppm · rank 459/3519 (87.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 261 aa |
|---|---|
| Molecular weight | 29.2 kDa |
| Theoretical pI | 5.11 |
| GRAVY | -0.319 (hydrophilic) |
| Aliphatic index | 69.6 |
| Aromaticity | 0.115 |
| Instability index | 43.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thioesterase | PF00975.27 | 1.1e-68 | 30–253 | Thioesterase domain |
Abhydrolase_6 | PF12697.14 | 3.7e-09 | 39–240 | Alpha/beta hydrolase family |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
6fvj |
X-ray diffraction | 2.6 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6fvj-assembly4_D |
1.00 | 0.94 | 5.8e-41 sig | 6fvj-assembly4_D TesA a major thioesterase from Mycobacterium tuberculosis |
6fvj-assembly5_E |
1.00 | 0.94 | 4.6e-39 sig | 6fvj-assembly5_E TesA a major thioesterase from Mycobacterium tuberculosis |
6fvj-assembly6_F |
1.00 | 0.95 | 1.1e-38 sig | 6fvj-assembly6_F TesA a major thioesterase from Mycobacterium tuberculosis |
6fw5-assembly1_A |
1.00 | 0.90 | 3.2e-40 sig | 6fw5-assembly1_A TesA a major thioesterase from Mycobacterium tuberculosis |
6fw5-assembly4_D |
1.00 | 0.90 | 5.8e-40 sig | 6fw5-assembly4_D TesA a major thioesterase from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 83.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2927c (- strand, 238 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2929 (+ strand, -14 bp gap) |
| Predicted operon |
tesA · Rv2929
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
Rv0324 (activates) · whiA (activates) · Rv3830c (activates) · espR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ppsB (phthiocerol synthesis polyketide synthase type I PpsB), high confidence from genomic context alone (score 919 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2932 ppsB exp |
phthiocerol synthesis polyketide synthase type I PpsB | 937 | 919 ctx | cooccurence:719 database:500 |
Rv2931 ppsA exp |
phthiocerol synthesis polyketide synthase type I PpsA | 934 | 907 ctx | cooccurence:705 database:500 |
Rv2933 ppsC exp |
phthiocerol synthesis polyketide synthase type I PpsC | 934 | 907 ctx | cooccurence:667 database:500 |
Rv3800c pks13 |
polyketide synthase | 940 | 905 ctx | cooccurence:483 coexpression:784 textmining:405 |
Rv2935 ppsE exp |
phthiocerol synthesis polyketide synthase type I PpsE | 958 | 888 ctx | cooccurence:742 database:500 textmining:648 |
Rv2934 ppsD exp |
phthiocerol synthesis polyketide synthase type I PpsD | 885 | 880 ctx | cooccurence:725 database:500 |
Rv0101 nrp |
peptide synthetase Nrp | 871 | 852 ctx | cooccurence:710 coexpression:446 |
Rv2380c mbtE |
peptide synthetase | 867 | 850 ctx | cooccurence:734 coexpression:415 |
Rv2383c mbtB |
phenyloxazoline synthase | 889 | 846 | coexpression:784 |
Rv1661 pks7 |
polyketide synthase | 868 | 828 ctx | cooccurence:693 |
Rv2048c pks12 |
polyketide synthase | 884 | 825 ctx | cooccurence:671 |
Rv0405 pks6 |
membrane bound polyketide synthase | 892 | 820 ctx | cooccurence:700 textmining:428 |
Rv2946c pks1 |
polyketide synthase | 868 | 814 ctx | cooccurence:639 |
Rv2929 hyp |
hypothetical protein | 810 | 810 ctx | neighborhood:801 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 860 | 771 ctx | cooccurence:568 textmining:417 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thioesterase TesA
- MTBC0 PGAP product: thioesterase TesA
- Pfam (hmmscan --cut_ga): Thioesterase PF00975.27 (E=1e-68), Abhydrolase_6 PF12697.14 (E=4e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217444.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thioesterase (PF00975.27), Abhydrolase_6 (PF12697.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3208 - Curated reference: UniProt P9WQD5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
61 functional partner(s); context anchor
ppsB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003111|Rv2928|tesA MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAFFGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPIYAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for tesA? Email the maintainer — the message is pre-filled with this gene's details.