tesA Resolved · high auto-curated

H37Rv Rv2928 · MTBC0 mtbc0_003111 · 261 aa · 3263195–3263980 (+) · RefSeq NP_217444.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thioesterase TesA
MTBC0 PGAP re-annotationthioesterase TesA
Revised (this work)Thioesterase TesA. Pfam: Thioesterase (PF00975.27), Abhydrolase_6 (PF12697.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQD5 SwissProt · reviewed · Evidence at protein level
UniProt nameThioesterase TesA
EC (curated) EC 3.1.1.6, EC 3.1.2.-, EC 3.1.2.2
Curated functionInvolved in the synthesis of both phthiocerol dimycocerosates (PDIMs) and phenolic glycolipids (PGLs), which are structurally related lipids non-covalently bound to the outer cell wall layer of M.tuberculosis and are important virulence factors. In vitro, TesA has both thioesterase and esterase activities. Exhibits thioesterase activity on acyl-CoA derivatives such as palmitoyl-CoA and decanoyl-CoA. Also displays hydrolytic activity on ester substrates, being more active on pNP esters with short carbon chain lengths (C2-C5) than with those bearing medium and long carbon chain lengths (C8-C18).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nametesA
eggNOG descriptionthioesterase
Orthologous groupCOG3208
Gene Ontology (47) GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009273, GO:0009605, GO:0009607, GO:0009987 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.3 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.89% of strains (1287) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThioesterasePF00975.27 1.1e-6830–253 Thioesterase domain
Abhydrolase_6PF12697.14 3.7e-0939–240 Alpha/beta hydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ppsB (phthiocerol synthesis polyketide synthase type I PpsB), high confidence from genomic context alone (score 919 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 937 919 ctx cooccurence:719 database:500
Rv2931 ppsA phthiocerol synthesis polyketide synthase type I PpsA 934 907 ctx cooccurence:705 database:500
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 934 907 ctx cooccurence:667 database:500
Rv3800c pks13 polyketide synthase 940 905 ctx cooccurence:483 coexpression:784 textmining:405
Rv2935 ppsE phthiocerol synthesis polyketide synthase type I PpsE 958 888 ctx cooccurence:742 database:500 textmining:648
Rv2934 ppsD phthiocerol synthesis polyketide synthase type I PpsD 885 880 ctx cooccurence:725 database:500
Rv0101 nrp peptide synthetase Nrp 871 852 ctx cooccurence:710 coexpression:446
Rv2380c mbtE peptide synthetase 867 850 ctx cooccurence:734 coexpression:415
Rv2383c mbtB phenyloxazoline synthase 889 846 coexpression:784
Rv1661 pks7 polyketide synthase 868 828 ctx cooccurence:693
Rv2048c pks12 polyketide synthase 884 825 ctx cooccurence:671
Rv0405 pks6 membrane bound polyketide synthase 892 820 ctx cooccurence:700 textmining:428
Rv2946c pks1 polyketide synthase 868 814 ctx cooccurence:639
Rv2929 hyp hypothetical protein 810 810 ctx neighborhood:801
Rv2940c mas multifunctional mycocerosic acid synthase 860 771 ctx cooccurence:568 textmining:417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thioesterase TesA
  • MTBC0 PGAP product: thioesterase TesA
  • Pfam (hmmscan --cut_ga): Thioesterase PF00975.27 (E=1e-68), Abhydrolase_6 PF12697.14 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217444.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thioesterase (PF00975.27), Abhydrolase_6 (PF12697.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3208
  • Curated reference: UniProt P9WQD5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor ppsB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003111|Rv2928|tesA
MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAFFGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPIYAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA