Rv1147 Family assigned · medium auto-curated

H37Rv Rv1147 · MTBC0 mtbc0_001232 · 216 aa · 1283341–1283991 (+) · RefSeq NP_215663.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmethyltransferase domain-containing protein
Revised (this work)Methyltransferase domain-containing protein. Pfam: Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06547 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
eggNOG descriptionMethyltransferase
Orthologous groupCOG2227

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.123 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_23PF13489.13 3.3e-1229–176 Methyltransferase domain
Methyltransf_25PF13649.13 4.8e-1047–138 Methyltransferase domain
Methyltransf_11PF08241.19 4.5e-1348–140 Methyltransferase domain
Methyltransf_12PF08242.19 1.6e-1048–140 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmpL13b (transmembrane transport protein), high confidence from genomic context alone (score 857 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1146 mmpL13b transmembrane transport protein 857 857 ctx neighborhood:490 coexpression:732
Rv1145 mmpL13a transmembrane transport protein 628 627 ctx neighborhood:454
Rv1867 hyp hypothetical protein 681 187 textmining:624
Rv0187 O-methyltransferase 710 100 textmining:691
Rv1151c cobB NAD-dependent protein deacylase 546 79 textmining:528
Rv1485 hemZ ferrochelatase 660 70 textmining:650
Rv1800 PPE28 PPE family protein PPE28 520 55 textmining:513
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 699 52 textmining:696
Rv1549 fadD11.1 Possible fatty-acid-CoA ligase FadD11.1 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase); Rv1549, (MTCY48.16c), len: 175 aa. Possible f 441 51 textmining:436
Rv1789 PPE26 PPE family protein PPE26 549 49 textmining:546
Rv1594 nadA quinolinate synthetase A 521 49 textmining:517
Rv1862 adhA alcohol dehydrogenase A 804 47 textmining:803
Rv1705c PPE22 PPE family protein PPE22 660 47 textmining:658
Rv1802 PPE30 PPE family protein PPE30 655 47 textmining:653
Rv1808 PPE32 PPE family protein PPE32 626 47 textmining:624

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: methyltransferase domain-containing protein
  • Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=3e-12), Methyltransf_25 PF13649.13 (E=5e-10), Methyltransf_11 PF08241.19 (E=5e-13), Methyltransf_12 PF08242.19 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215663.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2227
  • Curated reference: UniProt O06547 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor mmpL13b
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001232|Rv1147|
MTSGAAASASRVDHPLFARIWPVVAAHEAEAIRALRRENLAGLSGRVLEVGAGVGTNFAYYPVAVEQVIAMEPEPRLAAKARIAAADAPVPIVVTDKTVEEFRDTETFDAVVCSLVLCSVSDPGAVLAHLRSLLRRGGELRYLEHVASAGARGRVQRFVDATFWPRLAGNCHTHRHTERAILDAGFVVDSSRREWAFPAWVPLPVSELALGRAHRT