Rv1147 Family assigned · medium auto-curated
H37Rv Rv1147 · MTBC0 mtbc0_001232 ·
216 aa · 1283341–1283991 (+) ·
RefSeq NP_215663.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | methyltransferase domain-containing protein |
| Revised (this work) | Methyltransferase domain-containing protein. Pfam: Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06547
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | Methyltransferase |
| Orthologous group | COG2227 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.123 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Methyltransf_23 | PF13489.13 | 3.3e-12 | 29–176 | Methyltransferase domain |
Methyltransf_25 | PF13649.13 | 4.8e-10 | 47–138 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 4.5e-13 | 48–140 | Methyltransferase domain |
Methyltransf_12 | PF08242.19 | 1.6e-10 | 48–140 | Methyltransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mmpL13b (transmembrane transport protein), high confidence from genomic context alone (score 857 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1146 mmpL13b |
transmembrane transport protein | 857 | 857 ctx | neighborhood:490 coexpression:732 |
Rv1145 mmpL13a |
transmembrane transport protein | 628 | 627 ctx | neighborhood:454 |
Rv1867 hyp |
hypothetical protein | 681 | 187 | textmining:624 |
Rv0187 |
O-methyltransferase | 710 | 100 | textmining:691 |
Rv1151c cobB |
NAD-dependent protein deacylase | 546 | 79 | textmining:528 |
Rv1485 hemZ |
ferrochelatase | 660 | 70 | textmining:650 |
Rv1800 PPE28 |
PPE family protein PPE28 | 520 | 55 | textmining:513 |
Rv1341 rdgB |
non-canonical purine NTP pyrophosphatase | 699 | 52 | textmining:696 |
Rv1549 fadD11.1 |
Possible fatty-acid-CoA ligase FadD11.1 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase); Rv1549, (MTCY48.16c), len: 175 aa. Possible f | 441 | 51 | textmining:436 |
Rv1789 PPE26 |
PPE family protein PPE26 | 549 | 49 | textmining:546 |
Rv1594 nadA |
quinolinate synthetase A | 521 | 49 | textmining:517 |
Rv1862 adhA |
alcohol dehydrogenase A | 804 | 47 | textmining:803 |
Rv1705c PPE22 |
PPE family protein PPE22 | 660 | 47 | textmining:658 |
Rv1802 PPE30 |
PPE family protein PPE30 | 655 | 47 | textmining:653 |
Rv1808 PPE32 |
PPE family protein PPE32 | 626 | 47 | textmining:624 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: methyltransferase domain-containing protein
- Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=3e-12), Methyltransf_25 PF13649.13 (E=5e-10), Methyltransf_11 PF08241.19 (E=5e-13), Methyltransf_12 PF08242.19 (E=2e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215663.1)
- Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2227 - Curated reference: UniProt O06547 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
mmpL13b - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001232|Rv1147| MTSGAAASASRVDHPLFARIWPVVAAHEAEAIRALRRENLAGLSGRVLEVGAGVGTNFAYYPVAVEQVIAMEPEPRLAAKARIAAADAPVPIVVTDKTVEEFRDTETFDAVVCSLVLCSVSDPGAVLAHLRSLLRRGGELRYLEHVASAGARGRVQRFVDATFWPRLAGNCHTHRHTERAILDAGFVVDSSRREWAFPAWVPLPVSELALGRAHRT