Rv0272c Family assigned · medium

H37Rv Rv0272c · MTBC0 mtbc0_000289 · 377 aa · 328957–330090 (-) · RefSeq NP_214786.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta-hydrolase-fold enzyme (PGAP; Foldseek significant match to a cold-adapted esterase fold, E=7e-6, TM=0.65). Putative esterase/hydrolase; specific substrate not established.

Curated reference (UniProt)

UniProt P95229 TrEMBL · unreviewed · Evidence at protein level
UniProt nameAlpha/beta hydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionalpha beta
Orthologous groupCOG1073

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.222 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.59% of strains (2315) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4ao8-assembly1_A-2 1.00 0.65 7.1e-06 sig 4ao8-assembly1_A-2 PEG-bound complex of a novel cold-adapted esterase from an Arctic intertidal metagenomic library
8qzu-assembly1_A 1.00 0.55 3.1e-07 sig 8qzu-assembly1_A XhpG hydrolase mutant S98A of Xenorhabdus hominickii
4ao7-assembly1_A-2 1.00 0.65 1.6e-05 sig 4ao7-assembly1_A-2 Zinc bound structure of a novel cold-adapted esterase from an Arctic intertidal metagenomic library
4ao6-assembly1_A-2 1.00 0.65 4.3e-05 sig 4ao6-assembly1_A-2 Native structure of a novel cold-adapted esterase from an Arctic intertidal metagenomic library
6y9f-assembly1_A 1.00 0.54 3.4e-06 sig 6y9f-assembly1_A Crystal structure of putative ancestral haloalkane dehalogenase AncHLD3 (node 3)
2vax-assembly1_A 1.00 0.43 4.4e-07 sig 2vax-assembly1_A Crystal structure of deacetylcephalosporin C acetyltransferase (Cephalosporin C-soak)
2vav-assembly2_B 1.00 0.41 8.5e-07 sig 2vav-assembly2_B Crystal structure of deacetylcephalosporin C acetyltransferase (DAC-Soak)
2vav-assembly1_A 1.00 0.41 1.2e-06 sig 2vav-assembly1_A Crystal structure of deacetylcephalosporin C acetyltransferase (DAC-Soak)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0273c (transcriptional regulator), high confidence from genomic context alone (score 970 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0273c transcriptional regulator 969 970 ctx neighborhood:881 cooccurence:751
Rv0274 hyp hypothetical protein 898 898 ctx neighborhood:598 cooccurence:753
Rv0271c fadE6 acyl-CoA dehydrogenase FadE6 802 802 ctx neighborhood:757
Rv0311 hyp hypothetical protein 724 725 ctx cooccurence:723
Rv0138 hyp hypothetical protein 701 701 ctx cooccurence:701
Rv0767c HTH-type transcriptional regulator 694 694 ctx cooccurence:689
Rv3169 hyp hypothetical protein 643 644 ctx cooccurence:639
Rv0774c hyp hypothetical protein 646 625 ctx cooccurence:625
Rv0519c membrane protein 615 615 ctx cooccurence:615
Rv3810 pirG cell surface protein 576 576 ctx cooccurence:567
Rv1874 hyp hypothetical protein 555 555 ctx cooccurence:550
Rv0518 hyp hypothetical protein 542 541 ctx cooccurence:541
Rv0762c hyp hypothetical protein 525 526 ctx cooccurence:523
Rv1867 hyp hypothetical protein 506 507 ctx cooccurence:494
Rv3707c hyp hypothetical protein 484 485 ctx cooccurence:482

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'alpha/beta hydrolase'
  • Pfam: none above threshold
  • Foldseek on the ESMFold model: significant match to an alpha/beta-hydrolase esterase fold (E=7e-6, TM=0.65)

ESM Atlas signal (exploratory)

Ancestral protein hash 4d0ce477e917476314fb73a828536186 · 10 ESM-space neighbours (max similarity 0.926). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
111080 1.15 AB hydrolase charge-relay motif
213086 1.13 ABH cap/lid activation hotspots
310282 1.09 AB-hydrolase cap/lid segments
411204 1.06 AB-hydrolase N-terminal cap
55107 1.00 Serine-hydrolase nucleophile elbow
63636 0.99 AB-hydrolase catalytic His segment
713198 0.97 ABH lipase-box catalytic motif
813972 0.93 Alpha/beta hydrolase nucleophile/oxyanion loop

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214786.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1073
  • Curated reference: UniProt P95229 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor Rv0273c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000289|Rv0272c|
MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPKVALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLREVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAHPGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTITDWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAHGIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLASSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR