Rv1874 Family assigned · low auto-curated · to review

H37Rv Rv1874 · MTBC0 - · 228 aa · 2123684–2124370 (+) · RefSeq NP_216390.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 2ftr-assembly1_B Crystal structure of an ethyl tert-butyl ether d (ethd) family (prob 1.00, TM 0.62). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07755 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionEthD domain
Orthologous group28KNT

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 3.187 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 92.4 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2ftr-assembly1_B 1.00 0.62 4.6e-03 sig 2ftr-assembly1_B Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution
3f44-assembly1_A 1.00 0.48 4.4e-04 sig 3f44-assembly1_A Crystal structure of putative monooxygenase (YP_193413.1) from Lactobacillus acidophilus NCFM at 1.55 A resolution
5f9p-assembly2_B 0.98 0.48 3.2e-03 sig 5f9p-assembly2_B Crystal structure study of anthrone oxidase-like protein
3bgu-assembly1_A 0.96 0.54 1.4e-02 3bgu-assembly1_A Crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 A resolution
1r6y-assembly1_A 0.95 0.52 1.5e-02 1r6y-assembly1_A Crystal structure of YgiN from Escherichia coli
2qyc-assembly1_A 0.93 0.54 3.1e-02 2qyc-assembly1_A Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 A resolution
4d4f-assembly1_C 0.93 0.40 3.8e-03 sig 4d4f-assembly1_C Mutant P250A of bacterial chalcone isomerase from Eubacterium ramulus
4d4f-assembly1_F 0.92 0.41 7.9e-03 sig 4d4f-assembly1_F Mutant P250A of bacterial chalcone isomerase from Eubacterium ramulus

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0273c (transcriptional regulator), medium confidence from genomic context alone (score 629 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1875 hyp hypothetical protein 877 878 ctx neighborhood:874
Rv0138 hyp hypothetical protein 755 755 ctx cooccurence:755
Rv2910c hyp hypothetical protein 753 754 ctx cooccurence:753
Rv0293c hyp hypothetical protein 697 698 ctx cooccurence:696
Rv0310c hyp hypothetical protein 650 650 ctx cooccurence:646
Rv3577 hyp hypothetical protein 645 645 ctx cooccurence:645
Rv0273c transcriptional regulator 629 629 ctx cooccurence:624
Rv1873 hyp hypothetical protein 596 596 ctx neighborhood:593
Rv3810 pirG cell surface protein 595 595 ctx cooccurence:594
Rv2627c hyp hypothetical protein 593 593 ctx cooccurence:591
Rv1817 flavoprotein 583 583 ctx cooccurence:582
Rv3169 hyp hypothetical protein 567 568 ctx cooccurence:563
Rv0272c hyp hypothetical protein 555 555 ctx cooccurence:550
Rv3906c hyp hypothetical protein 552 553 ctx cooccurence:550
Rv1191 hyp hypothetical protein 552 553 ctx cooccurence:550

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 2ftr-assembly1_B Crystal structure of an ethyl tert-butyl ether d (ethd) family (prob 1.00, E=5e-03, TM=0.62)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216390.3)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KNT
  • Curated reference: UniProt O07755 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 92.4, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor Rv0273c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1874|
MLMRPEPDDDWCARQRAQVADALLGLGVAGLSINVRDSTVRDSLMTLTTLYPPVAAVVSLWTQQCYGEQVAAALRLLAQECDELGAYLVTESVPLTFPSLVESGSRTPGLANIALLRRPDGLDQATWLTRWQRDHTQVAIEAQATFGYTQNWVVRALTPEAPGIAGIVEELFPVAATTDLKAFFGAADDNDLRNRISRMVASTSAFGANQNIDTVPTSRYVFRTPFKD