Rv0150c Still unknown · low

H37Rv Rv0150c · MTBC0 mtbc0_000161 · 95 aa · 177011–177298 (-) · RefSeq NP_214664.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein. No Pfam domain above threshold and no Foldseek structural hit on the ESMFold model: genuinely uncharacterised at both sequence and structure level.

Curated reference (UniProt)

UniProt P96827 TrEMBL · unreviewed · Predicted
UniProt namePE family protein

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Evidence

  • MTBC0 PGAP product: 'hypothetical protein'
  • Pfam: no domain above threshold
  • Foldseek on the ESMFold model: no structural hit

ESM Atlas signal (exploratory)

Ancestral protein hash 7823d371a2220b3434241f870fa97a7e · 9 ESM-space neighbours (max similarity 0.592). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
116042 0.62 GNAT motif A acetyl-CoA loop-helix
211502 0.59 GNAT A-motif P-loop
315036 0.58 GNAT active-site helix
412228 0.54 Acyl-donor binding beta-alpha loop
51910 0.54 Glycine-rich acyl-donor loop
61802 0.53 GNAT acyltransferase catalytic loops
715656 0.53 GNAT-fold C-terminal cap
89182 0.52 Noncatalytic C-terminal cofactor/interaction module

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214664.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P96827 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 39.0, very low)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000161|Rv0150c|
MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTADIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA