Rv0150c Still unknown · low
H37Rv Rv0150c · MTBC0 mtbc0_000161 ·
95 aa · 177011–177298 (-) ·
RefSeq NP_214664.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein. No Pfam domain above threshold and no Foldseek structural hit on the ESMFold model: genuinely uncharacterised at both sequence and structure level. |
Curated reference (UniProt)
| UniProt |
P96827
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Evidence
- MTBC0 PGAP product: 'hypothetical protein'
- Pfam: no domain above threshold
- Foldseek on the ESMFold model: no structural hit
ESM Atlas signal (exploratory)
Ancestral protein hash 7823d371a2220b3434241f870fa97a7e ·
9 ESM-space neighbours (max similarity 0.592).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 16042 |
0.62 | GNAT motif A acetyl-CoA loop-helix |
| 2 | 11502 |
0.59 | GNAT A-motif P-loop |
| 3 | 15036 |
0.58 | GNAT active-site helix |
| 4 | 12228 |
0.54 | Acyl-donor binding beta-alpha loop |
| 5 | 1910 |
0.54 | Glycine-rich acyl-donor loop |
| 6 | 1802 |
0.53 | GNAT acyltransferase catalytic loops |
| 7 | 15656 |
0.53 | GNAT-fold C-terminal cap |
| 8 | 9182 |
0.52 | Noncatalytic C-terminal cofactor/interaction module |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214664.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P96827 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 39.0, very low)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000161|Rv0150c| MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTADIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA