Rv0143c Resolved · high auto-curated

H37Rv Rv0143c · MTBC0 mtbc0_000154 · 492 aa · 169050–170528 (-) · RefSeq NP_214657.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationchloride channel protein
Revised (this work)Chloride channel protein. Pfam: Voltage_CLC (PF00654.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96820 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameclcA
eggNOG descriptionChloride channel
Orthologous groupCOG0038
KEGG orthology K03281

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.487 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 8 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 0.73% of strains (1056) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Voltage_CLCPF00654.26 3.0e-85113–460 Voltage gated chloride channel

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0144 (transcriptional regulator), medium confidence from genomic context alone (score 559 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0144 transcriptional regulator 560 559 ctx neighborhood:555
Rv1762c hyp hypothetical protein 452 452 ctx cooccurence:421
Rv2101 helZ helicase HelZ 470 438
Rv3432c gadB glutamate decarboxylase GadB 466 432
Rv0145 S-adenosylmethionine-dependent methyltransferase 417 418 ctx neighborhood:414
Rv0146 S-adenosylmethionine-dependent methyltransferase 415 415 ctx neighborhood:413
Rv3256c hyp hypothetical protein 436 409 coexpression:409
Rv1899c lppD lipoprotein LppD 403 403
Rv3907c pcnA poly(A) polymerase PcnA 414 47 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: chloride channel protein
  • Pfam (hmmscan --cut_ga): Voltage_CLC PF00654.26 (E=3e-85)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214657.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Voltage_CLC (PF00654.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0038
  • Curated reference: UniProt P96820 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor Rv0144
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000154|Rv0143c|
MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLRKWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPWAIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTIGSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAALGASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVVIGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWAQLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLGELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAALLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA