Rv0311 Family assigned · medium

H37Rv Rv0311 · MTBC0 mtbc0_000331 · 409 aa · 382495–383724 (+) · RefSeq NP_214825.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Longin-like / alpha-beta-plait sensor (ligand-binding) domain; structural homology to DmpR/MopR aromatic-sensing transcriptional regulators, H-NOX gas sensors, and TRAPPC3; specific ligand undetermined RefSeq leaves this locus uncharacterised.

Curated reference (UniProt)

UniProt O07238 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28KAT

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.493 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.9 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5doe-assembly1_B 0.13 0.27 7.2e-01 5doe-assembly1_B Crystal structure of the Human Cytomegalovirus UL53 (residues 72-292)
5doc-assembly1_A 0.08 0.23 1.2e+00 5doc-assembly1_A Crystal structure of the Human Cytomegalovirus UL53 subunit of the NEC
7t7i-assembly2_H 0.08 0.27 2.1e+00 7t7i-assembly2_H EBV nuclear egress complex
5fki-assembly1_1A 0.08 0.18 5.0e-01 5fki-assembly1_1A Pseudorabies virus (PrV) nuclear egress complex proteins fitted as a hexameric lattice into a sub-tomogram average derived from focused- ion beam milled lamellae electron cryo-microscopic data
8g6d-assembly1_D 0.08 0.24 1.3e+00 8g6d-assembly1_D HSV-1 Nuclear Egress Complex (SUP; UL31-R229L)
5dob-assembly1_A 0.07 0.23 1.7e+00 5dob-assembly1_A Crystal structure of the Human Cytomegalovirus Nuclear Egress Complex (NEC)
5e8c-assembly1_A 0.07 0.25 1.9e+00 5e8c-assembly1_A pseudorabies virus nuclear egress complex, pUL31, pUL34
5doc-assembly1_B 0.06 0.26 3.0e+00 5doc-assembly1_B Crystal structure of the Human Cytomegalovirus UL53 subunit of the NEC

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0771 (4-carboxymuconolactone decarboxylase), high confidence from genomic context alone (score 820 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0310c hyp hypothetical protein 896 896 ctx neighborhood:645 cooccurence:718
Rv0771 4-carboxymuconolactone decarboxylase 820 820 ctx neighborhood:424 cooccurence:699
Rv0762c hyp hypothetical protein 819 819 ctx cooccurence:774
Rv0767c HTH-type transcriptional regulator 818 819 ctx cooccurence:774
Rv0765c oxidoreductase 771 772 ctx cooccurence:714
Rv0764c cyp51 lanosterol 14-alpha demethylase 761 760 ctx cooccurence:749
Rv0312 hyp hypothetical protein 749 749 ctx neighborhood:749
Rv0272c hyp hypothetical protein 724 725 ctx cooccurence:723
Rv3169 hyp hypothetical protein 718 718 ctx cooccurence:717
Rv0763c ferredoxin 714 714 ctx cooccurence:667
Rv0926c hyp hypothetical protein 687 688 ctx cooccurence:686
Rv0138 hyp hypothetical protein 663 663 ctx cooccurence:663
Rv1776c transcriptional regulator 646 646 ctx cooccurence:646
Rv3531c hyp hypothetical protein 636 637 ctx cooccurence:635
Rv1628c hyp hypothetical protein 620 620 ctx cooccurence:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred (Neff 8.68): top hit 7YH3 TRAPPC3 longin 98.2% E3.2e-5; DmpR/MopR phenol-sensing regulators 97%; H-NOX NO/O2 sensors 95% - all share the longin/sensor alpha-beta-plait fold
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214825.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KAT
  • Curated reference: UniProt O07238 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.9, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor Rv0771
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000331|Rv0311|
MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEMLQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWHGEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPADRHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLDFGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAERIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTPASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFEPRRSLPLTVK