Rv0149 Family assigned · medium auto-curated

H37Rv Rv0149 · MTBC0 mtbc0_000160 · 322 aa · 176046–177014 MTBC0 (+) · RefSeq NP_214663.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand cyp138 (Rv0136) — requalified: cytochrome P450 msrA (Rv0137c) — requalified: peptide-methionine (S)-S-oxide reductase MsrA Rv0138 (Rv0138) — family_assigned: nuclear transport factor 2 family protein Rv0139 (Rv0139) — family_assigned: NAD-dependent epimerase/dehydratase family protein Rv0139 Rv0140 (Rv0140) — family_assigned: DUF427 domain-containing protein Rv0141c (Rv0141c) — family_assigned: nuclear transport factor 2 family protein Rv0142 (Rv0142) — requalified: DNA-3-methyladenine glycosylase Rv0142 Rv0143c (Rv0143c) — requalified: chloride channel protein Rv0143c Rv0145 (Rv0145) — requalified: class I SAM-dependent methyltransferase Rv0145 Rv0146 (Rv0146) — requalified: class I SAM-dependent methyltransferase Rv0146 Rv0148 (Rv0148) — family_assigned: SDR family oxidoreductase Rv0148 Rv0149 (Rv0149) — family_assigned: NADPH:quinone oxidoreductase family protein Rv0149 Rv0150c (Rv0150c) — dark: hypothetical protein ptbB (Rv0153c) — requalified: tyrosine-protein phosphatase PtbB ptbB fadE2 (Rv0154c) — requalified: acyl-CoA dehydrogenase fadE2 pntAa (Rv0155) — family_assigned: Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha pntAa pntAb (Rv0156) — family_assigned: NAD(P) transhydrogenase subunit alpha pntB (Rv0157) — family_assigned: NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta pntB Rv0158 (Rv0158) — family_assigned: TetR/AcrR family transcriptional regulator 168 kb 172 kb 176 kb 180 kb 184 kb 188 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)quinone oxidoreductase
MTBC0 PGAP re-annotationNADPH:quinone oxidoreductase family protein
Revised (this work)NADPH:quinone oxidoreductase family protein. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 0 % of gene

NeighbourRv0150c (Rv0150c, - strand)
Overlap4 bp, 0 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.05 (95% CI -2.23 to 5.65). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionPossibly binds NADP and acts through a one-electron transfer process. Quinones are supposed to be the best substrates. May act in the detoxification of xenobiotics [catalytic activity: NADPH + quinone = NADP+ + semiquinone]
Mycobrowser EC 1.6.5.5 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0154 · 100.0% identity
M. marinum MMAR_0361 · 82.6% identity
M. smegmatis MSMEG_0097 · 63.6% identity
M. orygis RJtmp_000160 · 100.0% identity
M. abscessus MAB_4603c · 60.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P96826 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible quinone oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionalcohol dehydrogenase
Orthologous groupCOG0604
EC number EC 1.6.5.5
KEGG orthology K00344

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.466 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 8 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 6.00% of strains (8708) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.091 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 65.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 41.8%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 22 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 22 growth-advantage. Saturation 0.955, mean read count 144.952380952. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance64.6 ppm · rank 1592/3519 (54.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length322 aa
Molecular weight33.3 kDa
Theoretical pI4.93
GRAVY0.415 (hydrophobic)
Aliphatic index110.8
Aromaticity0.065
Instability index29.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 3.7e-1328–108 Alcohol dehydrogenase GroES-like domain
ADH_zinc_NPF00107.33 3.7e-28150–272 Zinc-binding dehydrogenase
ADH_zinc_N_2PF13602.13 1.5e-12183–320 Zinc-binding dehydrogenase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.3

PDB hitprobTM-scoreE-valueDescription
1yb5-assembly1_A 1.00 0.93 9.2e-29 sig 1yb5-assembly1_A Crystal structure of human Zeta-Crystallin with bound NADP
6k9y-assembly2_C 1.00 0.91 1.0e-28 sig 6k9y-assembly2_C Crystal structure of human VAT-1
3jyl-assembly1_A 1.00 0.90 2.3e-28 sig 3jyl-assembly1_A Crystal structures of Pseudomonas syringae pv. Tomato DC3000 quinone oxidoreductase
5dp1-assembly1_A 1.00 0.90 1.9e-28 sig 5dp1-assembly1_A Crystal structure of CurK enoyl reductase
2j8z-assembly1_A-2 1.00 0.89 1.9e-28 sig 2j8z-assembly1_A-2 Crystal Structure of human P53 inducible oxidoreductase (TP53I3,PIG3)

Foldseek search of the AlphaFold DB model (mean pLDDT 95.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv0148 (+ strand, 6 bp gap)
Downstream (3' on genome)Rv0150c (- strand, -4 bp gap)
Predicted operon Rv0148 · Rv0149

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0148 (short-chain type dehydrogenase/reductase), high confidence from genomic context alone (score 903 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0148 short-chain type dehydrogenase/reductase 903 903 ctx neighborhood:882
Rv0147 aldehyde dehydrogenase 835 830 ctx neighborhood:789
Rv0130 htdZ 3-hydroxyl-thioester dehydratase 710 703 ctx fusion:575
Rv0146 S-adenosylmethionine-dependent methyltransferase 509 508 ctx neighborhood:503
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 495 496 ctx cooccurence:424
Rv3761c fadE36 acyl-CoA dehydrogenase FadE36 477 478
Rv0145 S-adenosylmethionine-dependent methyltransferase 476 477 ctx neighborhood:470
Rv1240 mdh malate dehydrogenase 405 96

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: quinone oxidoreductase
  • MTBC0 PGAP product: NADPH:quinone oxidoreductase family protein
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=4e-13), ADH_zinc_N PF00107.33 (E=4e-28), ADH_zinc_N_2 PF13602.13 (E=2e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214663.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0604
  • Curated reference: UniProt P96826 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor Rv0148
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000160|Rv0149|
MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANVVRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQAGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP