Rv3572 Still unknown · low auto-curated

H37Rv Rv3572 · MTBC0 mtbc0_003791 · 176 aa · 4037188–4037718 (+) · RefSeq NP_218089.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 1f0l-assembly2_B 1.55 ANGSTROM CRYSTAL STRUCTURE OF WILD TYPE DIPHTHER (prob 0.92, TM 0.36).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X7P2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSecreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ARAU

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.452 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (283) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 90.4 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1f0l-assembly2_B 0.92 0.36 1.3e-02 1f0l-assembly2_B 1.55 ANGSTROM CRYSTAL STRUCTURE OF WILD TYPE DIPHTHERIA TOXIN
6qh7-assembly1_M 0.90 0.39 2.5e-02 6qh7-assembly1_M AP2 clathrin adaptor mu2T156-phosphorylated core with two cargo peptides in open+ conformation
1f0l-assembly1_A 0.90 0.32 6.7e-03 sig 1f0l-assembly1_A 1.55 ANGSTROM CRYSTAL STRUCTURE OF WILD TYPE DIPHTHERIA TOXIN
7k7c-assembly1_A 0.89 0.34 1.2e-02 7k7c-assembly1_A Crystal structure of diphtheria toxin from crystals obtained at pH 5.5
7oi5-assembly2_D 0.85 0.33 1.2e-02 7oi5-assembly2_D Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
3ml6-assembly3_C 0.85 0.36 1.6e-02 3ml6-assembly3_C a complex between Dishevelled2 and clathrin adaptor AP-2
7k7d-assembly1_A 0.84 0.33 1.7e-02 7k7d-assembly1_A Crystal structure of diphtheria toxin from crystals obtained at pH 6.0
8g0f-assembly1_B 0.84 0.31 1.1e-02 8g0f-assembly1_B Crystal structure of diphtheria toxin H223Q/H257Q double mutant (pH 5.5)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: kshB (3-ketosteroid-9-alpha-hydroxylase reductase subunit), high confidence from genomic context alone (score 857 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3571 kshB 3-ketosteroid-9-alpha-hydroxylase reductase subunit 857 857 ctx neighborhood:855
Rv3567c hsaB flavin-dependent monooxygenase reductase subunit HsaB 749 748 ctx neighborhood:745
Rv3569c hsaD 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase 733 734 ctx neighborhood:731
Rv3568c hsaC extradiol dioxygenase 675 676 ctx neighborhood:671
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 565 566 ctx neighborhood:560
Rv3527 hyp hypothetical protein 757 55 textmining:754
Rv1139c hyp hypothetical protein 656 47 textmining:654
Rv3668c protease 653 46 textmining:652
Rv1887 hyp hypothetical protein 542 46 textmining:540
Rv2781c oxidoreductase 724 44 textmining:724
Rv3036c TB22.2 hyp hypothetical protein 629 41 textmining:629
Rv0196 HTH-type transcriptional regulator 618 41 textmining:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 1f0l-assembly2_B 1.55 ANGSTROM CRYSTAL STRUCTURE OF WILD TYPE DIPHTHERIA TOXIN (prob 0.92, E=1e-02, TM=0.36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218089.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ARAU
  • Curated reference: UniProt I6X7P2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 90.4, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor kshB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003791|Rv3572|
MTRLIPGCTLVGLMLTLLPAPTSAAGSNTATTLFPVDEVTQLETHTFLDCHPNGSCDFVAGANLRTPDGPTGFPPGLWARQTTEIRSTNRLAYLDAHATSQFERVMKAGGSDVITTVYFGEGPPDKYQTTGVIDSTNWSTGQPMTDVNVIVCTHMQVVYPGVNLTSPSTCAQANFS