mosR Family assigned · low auto-curated
H37Rv Rv0348 · MTBC0 mtbc0_000368 ·
217 aa · 421616–422269 (+) ·
RefSeq NP_214862.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | hypoxia/intracellular survival transcriptional regulator MosR |
| Revised (this work) | Hypoxia/intracellular survival transcriptional regulator MosR. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06299
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible transcriptional regulatory protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2BXAD |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0347 (membrane protein), high confidence from genomic context alone (score 886 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0347 |
membrane protein | 886 | 886 ctx | neighborhood:882 |
Rv0349 hyp |
hypothetical protein | 810 | 810 ctx | neighborhood:809 |
Rv1267c embR |
transcriptional regulator EmbR | 797 | 797 | coexpression:797 |
Rv0212c nadR |
transcriptional regulator NadR | 751 | 751 | coexpression:751 |
Rv3082c virS |
HTH-type transcriptional regulator VirS | 746 | 746 | coexpression:746 |
Rv3167c |
TetR family transcriptional regulator | 746 | 746 | coexpression:746 |
Rv0452 |
transcriptional regulator | 734 | 734 | coexpression:734 |
Rv0494 |
HTH-type transcriptional regulator | 733 | 733 | coexpression:733 |
Rv1963c mce3R |
transcriptional repressor Mce3R | 732 | 732 | coexpression:732 |
Rv1931c |
transcriptional regulator | 730 | 730 | coexpression:730 |
Rv1674c |
transcriptional regulator | 729 | 729 | coexpression:729 |
Rv2912c |
TetR family HTH-type transcriptional regulator | 553 | 553 | coexpression:553 |
Rv2359 zur |
zinc uptake regulation protein | 514 | 514 | coexpression:514 |
Rv3055 |
TetR family transcriptional regulator | 457 | 458 | coexpression:458 |
Rv0350 dnaK |
chaperone protein DnaK | 455 | 455 ctx | neighborhood:449 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator
- MTBC0 PGAP product: hypoxia/intracellular survival transcriptional regulator MosR
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214862.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BXAD - Curated reference: UniProt O06299 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
Rv0347 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000368|Rv0348|mosR MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQFTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPAITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERGRYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR