aspB Resolved · high auto-curated

H37Rv Rv3565 · MTBC0 mtbc0_003782 · 388 aa · 4029877–4031043 (+) · RefSeq NP_218082.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)aspartate aminotransferase AspB
MTBC0 PGAP re-annotationpyridoxal phosphate-dependent aminotransferase
Revised (this work)Pyridoxal phosphate-dependent aminotransferase. Pfam: Aminotran_1_2 (PF00155.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96847 SwissProt · reviewed · Evidence at protein level
UniProt nameValine--pyruvate aminotransferase
EC (curated) EC 2.6.1.66

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameaspB
eggNOG descriptionAminotransferase
Orthologous groupCOG0436
EC number EC 2.6.1.1, EC 2.6.1.17, EC 2.6.1.2, EC 2.6.1.66
KEGG orthology K00812, K14260, K14267
KEGG pathways map00220, map00250, map00270, map00290, map00300, map00330, map00350, map00360, map00400, map00401, map00950, map00960, map01100, map01110, map01120, map01130, map01210, map01230
KEGG modules M00016

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.257 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aminotran_1_2PF00155.28 9.4e-5832–381 Aminotransferase class I and II

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE33 (acyl-CoA dehydrogenase FadE33), high confidence from genomic context alone (score 976 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3564 fadE33 acyl-CoA dehydrogenase FadE33 976 976 ctx neighborhood:882 coexpression:804
Rv3563 fadE32 acyl-CoA dehydrogenase FadE32 967 968 ctx neighborhood:881 coexpression:740
Rv3561 fadD3 fatty-acid--CoA ligase FadD3 945 944 ctx neighborhood:801 coexpression:732
Rv3562 fadE31 acyl-CoA dehydrogenase FadE31 945 910 ctx neighborhood:881 textmining:423
Rv3559c oxidoreductase 883 786 ctx neighborhood:610 coexpression:404 textmining:478
Rv3838c pheA prephenate dehydratase 779 768 ctx fusion:528 database:500
Rv3709c ask aspartokinase 677 646 database:500
Rv3560c fadE30 acyl-CoA dehydrogenase FadE30 692 644 ctx neighborhood:612
Rv0393 hyp hypothetical protein 443 444
Rv1293 lysA diaminopimelate decarboxylase 474 425 coexpression:404
Rv3042c serB2 phosphoserine phosphatase SerB 402 365
Rv3859c gltB glutamate synthase large subunit 599 287 textmining:462
Rv2438c nadE glutamine-dependent NAD(+) synthetase 420 248
Rv2220 glnA1 glutamine synthetase 402 207
Rv1295 thrC threonine synthase 518 205 textmining:419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: aspartate aminotransferase AspB
  • MTBC0 PGAP product: pyridoxal phosphate-dependent aminotransferase
  • Pfam (hmmscan --cut_ga): Aminotran_1_2 PF00155.28 (E=9e-58)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218082.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aminotran_1_2 (PF00155.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0436
  • Curated reference: UniProt P96847 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor fadE33
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003782|Rv3565|aspB
MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRIGSWLPSQ