ispF Resolved · high auto-curated

H37Rv Rv3581c · MTBC0 mtbc0_003800 · 159 aa · 4047545–4048024 MTBC0 (-) · RefSeq NP_218098.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand hsaA (Rv3570c) — family_assigned: flavin-dependent monooxygenase oxygenase subunit HsaA kshB (Rv3571) — family_assigned: 3-ketosteroid-9-alpha-hydroxylase reductase subunit kshB Rv3572 (Rv3572) — family_assigned: hypothetical protein fadE34 (Rv3573c) — requalified: acyl-CoA dehydrogenase fadE34 kstR (Rv3574) — family_assigned: cholesterol catabolism transcriptional regulator KstR Rv3575c (Rv3575c) — family_assigned: LacI family DNA-binding transcriptional regulator Rv3575c arsB2 (Rv3578) — requalified: arsenic transport integral membrane protein ArsB arsB2 rlmB (Rv3579c) — requalified: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB rlmB ispF (Rv3581c) — requalified: 2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase ispD (Rv3582c) — requalified: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase carD (Rv3583c) — requalified: RNA polymerase-binding transcription factor CarD lpqE (Rv3584) — family_assigned: hypothetical protein radA (Rv3585) — requalified: DNA repair protein RadA radA disA (Rv3586) — requalified: DNA integrity scanning diadenylate cyclase DisA disA Rv3587c (Rv3587c) — family_assigned: hypothetical protein canB (Rv3588c) — requalified: beta-carbonic anhydrase CanB mutY (Rv3589) — requalified: A/G-specific adenine glycosylase mutY Rv3591c (Rv3591c) — family_assigned: alpha/beta hydrolase mhuD (Rv3592) — requalified: mycobilin-forming heme oxygenase MhuD lpqF (Rv3593) — requalified: serine hydrolase lpqF Rv3594 (Rv3594) — requalified: N-acetylmuramoyl-L-alanine amidase 4 036 kb 4 040 kb 4 044 kb 4 048 kb 4 052 kb 4 056 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
MTBC0 PGAP re-annotation2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase
Revised (this work)2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase. Pfam: YgbB (PF02542.22).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 10 publications

10 TB publications mention this gene. 10 publication(s) discuss this gene (9 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (4)).

Most recent 5 of 10.
PublicationDate
Identification of IspD as a novel target for tuberculosis treatment using compound M6. doi:10.3389/fmicb.2024.1461227 2024
Targeted suppression of MEP pathway genes DXS, IspD and IspF to explore the mycobacterial metabolism and survival. doi:10.1016/j.ijbiomac.2024.132727 2024
Comparative transcriptome analysis of roots, stems and leaves of Isodon amethystoides reveals candidate genes involved in Wangzaozins biosynthesis. doi:10.1186/s12870-018-1505-0 2018
The MEP pathway in Babesia orientalis apicoplast, a potential target for anti-babesiosis drug development. doi:10.1186/s13071-018-3038-7 2018
The Methylerythritol Phosphate Pathway: Promising Drug Targets in the Fight against Tuberculosis. doi:10.1021/acsinfecdis.7b00176 2018

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourispD (Rv3582c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -7.07 (95% CI -7.90 to -6.22). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fifth step). Converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP.
Mycobrowser EC 4.6.1.12 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3612c · 99.4% identity
M. leprae ML0322 · 80.8% identity
M. marinum MMAR_5081 · 93.1% identity
M. smegmatis MSMEG_6075 · 75.5% identity
M. orygis RJtmp_003689 · 99.4% identity
M. abscessus MAB_0570 · 72.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WKG5 SwissProt · reviewed · Evidence at protein level
UniProt name2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
EC (curated) EC 4.6.1.12
Curated functionInvolved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameispF
eggNOG descriptionInvolved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4- diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP)
Orthologous groupCOG0245
EC number EC 2.7.7.60, EC 4.6.1.12
KEGG orthology K01770, K12506
KEGG pathways map00900, map01100, map01110, map01130
KEGG modules M00096
Gene Ontology (23) GO:0003674, GO:0003824, GO:0006629, GO:0006720, GO:0006721, GO:0008150, GO:0008152, GO:0008299, GO:0008610, GO:0008685, GO:0009058, GO:0009987 +11 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 85.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.6%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 6 in the ORF — 5 in the essential state, 0 growth-defect, 0 non-essential, 1 growth-advantage. Saturation 0.333, mean read count 5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainispF-TetOn18 (TetON promoter 18)
Baseline knockdown fitness4.682 median doublings (across 5 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionno (Excluded - not in all screening waves)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance156.0 ppm · rank 999/3519 (71.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length159 aa
Molecular weight16.5 kDa
Theoretical pI6.16
GRAVY0.303 (hydrophobic)
Aliphatic index110.3
Aromaticity0.038
Instability index25.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YgbBPF02542.22 1.2e-526–155 YgbB family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.3

PDB hitprobTM-scoreE-valueDescription
2uzh-assembly1_C 1.00 0.99 1.2e-29 sig 2uzh-assembly1_C Mycobacterium smegmatis 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF)
2uzh-assembly1_B 1.00 0.98 1.6e-29 sig 2uzh-assembly1_B Mycobacterium smegmatis 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF)
5b8f-assembly1_B 1.00 0.94 1.5e-22 sig 5b8f-assembly1_B X-ray Crystal Structure of a 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Pseudomonas aeruginosa
3f0f-assembly1_C 1.00 0.94 5.2e-22 sig 3f0f-assembly1_C Co-crystal structure of 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Burkholderia pseudomallei with hydrolyzed CDP
1t0a-assembly1_C 1.00 0.94 5.6e-22 sig 1t0a-assembly1_C Crystal Structure of 2C-Methyl-D-Erythritol-2,4-cyclodiphosphate Synthase from Shewanella Oneidensis

Foldseek search of the AlphaFold DB model (mean pLDDT 96.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)cysS1 (- strand, 64 bp gap)
Downstream (3' on genome)ispD (- strand, -4 bp gap)
Predicted operon ispF · ispD · Rv3583c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (3 TF) Rv0576 (represses) · Rv2034 (represses) · mtrA (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: ispD (2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3582c ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 999 1000 ctx neighborhood:882 fusion:900 cooccurence:770 coexpression:949 textmining:965
Rv2868c gcpE exp 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 998 978 ctx cooccurence:774 database:900 textmining:936
Rv1011 ispE exp 4-diphosphocytidyl-2C-methyl-D-erythritol kinase 998 978 ctx cooccurence:756 database:900 textmining:956
Rv3583c carD RNA polymerase-binding transcription factor CarD 877 871 ctx neighborhood:865
Rv3579c rlmB 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB 808 802 ctx neighborhood:799
Rv3580c cysS1 cysteine--tRNA ligase 801 802 ctx neighborhood:799
Rv2870c dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase 988 792 ctx cooccurence:773 textmining:948
Rv3382c lytB1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 964 780 ctx cooccurence:764 textmining:844
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 906 776 ctx cooccurence:762 textmining:600
Rv2682c dxs1 1-deoxy-D-xylulose 5-phosphate synthase 971 756 ctx cooccurence:735 textmining:889
Rv3379c dxs2 1-deoxy-D-xylulose-5-phosphate synthase 853 731 ctx cooccurence:715 textmining:477
Rv3586 disA DNA integrity scanning protein DisA 546 546 ctx neighborhood:509
Rv3585 radA DNA repair protein RadA 491 491 ctx neighborhood:453
Rv3584 lpqE lipoprotein LpqE 451 451 ctx neighborhood:448
Rv0904c accD3 acetyl-CoAcarboxylase carboxyl transferase subunit beta 458 436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • MTBC0 PGAP product: 2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase
  • Pfam (hmmscan --cut_ga): YgbB PF02542.22 (E=1e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218098.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YgbB (PF02542.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0245
  • Curated reference: UniProt P9WKG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor ispD
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003800|Rv3581c|ispF
MNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR