ispF Resolved · high auto-curated

H37Rv Rv3581c · MTBC0 mtbc0_003800 · 159 aa · 4047545–4048024 (-) · RefSeq NP_218098.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
MTBC0 PGAP re-annotation2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase
Revised (this work)2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase. Pfam: YgbB (PF02542.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKG5 SwissProt · reviewed · Evidence at protein level
UniProt name2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
EC (curated) EC 4.6.1.12
Curated functionInvolved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameispF
eggNOG descriptionInvolved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4- diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP)
Orthologous groupCOG0245
EC number EC 2.7.7.60, EC 4.6.1.12
KEGG orthology K01770, K12506
KEGG pathways map00900, map01100, map01110, map01130
KEGG modules M00096
Gene Ontology (23) GO:0003674, GO:0003824, GO:0006629, GO:0006720, GO:0006721, GO:0008150, GO:0008152, GO:0008299, GO:0008610, GO:0008685, GO:0009058, GO:0009987 +11 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YgbBPF02542.22 1.2e-526–155 YgbB family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ispD (2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3582c ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 999 1000 ctx neighborhood:882 fusion:900 cooccurence:770 coexpression:949 textmining:965
Rv2868c gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 998 978 ctx cooccurence:774 database:900 textmining:936
Rv1011 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase 998 978 ctx cooccurence:756 database:900 textmining:956
Rv3583c carD RNA polymerase-binding transcription factor CarD 877 871 ctx neighborhood:865
Rv3579c rlmB 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB 808 802 ctx neighborhood:799
Rv3580c cysS1 cysteine--tRNA ligase 801 802 ctx neighborhood:799
Rv2870c dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase 988 792 ctx cooccurence:773 textmining:948
Rv3382c lytB1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 964 780 ctx cooccurence:764 textmining:844
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 906 776 ctx cooccurence:762 textmining:600
Rv2682c dxs1 1-deoxy-D-xylulose 5-phosphate synthase 971 756 ctx cooccurence:735 textmining:889
Rv3379c dxs2 1-deoxy-D-xylulose-5-phosphate synthase 853 731 ctx cooccurence:715 textmining:477
Rv3586 disA DNA integrity scanning protein DisA 546 546 ctx neighborhood:509
Rv3585 radA DNA repair protein RadA 491 491 ctx neighborhood:453
Rv3584 lpqE lipoprotein LpqE 451 451 ctx neighborhood:448
Rv0904c accD3 acetyl-CoAcarboxylase carboxyl transferase subunit beta 458 436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • MTBC0 PGAP product: 2-C-methyl-D-erythritol 2%2C4-cyclodiphosphate synthase
  • Pfam (hmmscan --cut_ga): YgbB PF02542.22 (E=1e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218098.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YgbB (PF02542.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0245
  • Curated reference: UniProt P9WKG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor ispD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003800|Rv3581c|ispF
MNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR