Rv1404 Family assigned · medium auto-curated

H37Rv Rv1404 · MTBC0 mtbc0_001505 · 160 aa · 1589935–1590417 (+) · RefSeq NP_215920.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationMarR family transcriptional regulator
Revised (this work)MarR family transcriptional regulator. Pfam: MarR_2 (PF12802.14), MarR (PF01047.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71672 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionMarR family
Orthologous groupCOG1846

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.093 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MarR_2PF12802.14 3.3e-1042–100 MarR family
MarRPF01047.29 4.2e-1843–100 MarR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1403c (methyltransferase), medium confidence from genomic context alone (score 580 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1403c methyltransferase 900 580 ctx neighborhood:574 textmining:773
Rv1619 hyp hypothetical protein 538 519 ctx cooccurence:517
Rv2060 integral membrane protein 475 447
Rv0678 mmpR5 hyp hypothetical protein 474 326
Rv0194 multidrug ABC transporter ATPase/permease 576 257 textmining:454
Rv1407 fmu 16S rRNA m5C967 methyltransferase 566 175 textmining:497
Rv1405c methyltransferase 887 166 textmining:870
Rv0880 HTH-type transcriptional regulator 789 162 textmining:759
Rv3291c lrpA transcriptional regulator LrpA 820 84 textmining:812
Rv0560c benzoquinone methyltransferase 739 52 textmining:737
Rv1986 lysE amino acid transporter 428 50 textmining:423
Rv1185c fadD21 fatty-acid--CoA ligase FadD21 415 50 textmining:410
Rv0193c hyp hypothetical protein 870 46 textmining:870
Rv2887 HTH-type transcriptional regulator 870 44 textmining:870
Rv0195 two component transcriptional regulator 456 44 textmining:455

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: MarR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): MarR_2 PF12802.14 (E=3e-10), MarR PF01047.29 (E=4e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215920.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MarR_2 (PF12802.14), MarR (PF01047.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1846
  • Curated reference: UniProt P71672 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv1403c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001505|Rv1404|
MMPTEYPATAEESVDVITDALLTASRLLVAISAHSIAQVDENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEAGGEPDARYEIE