hsaB Family assigned · medium auto-curated

H37Rv Rv3567c · MTBC0 mtbc0_003786 · 187 aa · 4032396–4032959 (-) · RefSeq NP_218084.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)flavin-dependent monooxygenase reductase subunit HsaB
MTBC0 PGAP re-annotationflavin-dependent monooxygenase reductase subunit HsaB
Revised (this work)Flavin-dependent monooxygenase reductase subunit HsaB. Pfam: Flavin_Reduct (PF01613.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WND9 SwissProt · reviewed · Evidence at protein level
UniProt nameFlavin-dependent monooxygenase, reductase subunit HsaB
EC (curated) EC 1.5.1.36
Curated functionCatalyzes the reduction of free flavins (FMN or FAD) by NADH. Subsequently, the reduced flavins diffuse to the HsaA oxygenase subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namehsaB
eggNOG descriptionCOG1853 Conserved protein domain typically associated with flavoprotein oxygenases, DIM6 NTAB family
Orthologous groupCOG1853
KEGG orthology K16048
KEGG pathways map00984, map01100
Gene Ontology (46) GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0006066, GO:0006629, GO:0006694, GO:0006706, GO:0006707, GO:0008150, GO:0008152, GO:0008202 +34 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.222 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Flavin_ReductPF01613.25 5.8e-4715–160 Flavin reductase like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hsaC (extradiol dioxygenase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3568c hsaC extradiol dioxygenase 999 998 ctx neighborhood:869 coexpression:838 database:900 textmining:913
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 999 992 ctx neighborhood:858 database:900 textmining:915
Rv3569c hsaD 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase 995 963 ctx neighborhood:869 coexpression:731 textmining:870
Rv3566A hyp hypothetical protein 826 826 ctx neighborhood:412 coexpression:716
Rv3571 kshB 3-ketosteroid-9-alpha-hydroxylase reductase subunit 927 795 ctx neighborhood:758 textmining:662
Rv3572 hyp hypothetical protein 749 748 ctx neighborhood:745
Rv3566c nat arylamine N-acetyltransferase 713 607 ctx neighborhood:419
Rv3192 hyp hypothetical protein 401 377
Rv3518c cyp142 cytochrome P450 monooxygenase Cyp142 558 370
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 569 252 textmining:448
Rv3537 kstD 3-oxosteroid 1-dehydrogenase 774 234 textmining:718
Rv3573c fadE34 acyl-CoA dehydrogenase FadE34 448 191
Rv3534c hsaF 4-hydroxy-2-oxovalerate aldolase 687 88 textmining:671
Rv3536c hsaE hydratase 688 86 textmining:674
Rv3564 fadE33 acyl-CoA dehydrogenase FadE33 457 85 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: flavin-dependent monooxygenase reductase subunit HsaB
  • MTBC0 PGAP product: flavin-dependent monooxygenase reductase subunit HsaB
  • Pfam (hmmscan --cut_ga): Flavin_Reduct PF01613.25 (E=6e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218084.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Flavin_Reduct (PF01613.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1853
  • Curated reference: UniProt P9WND9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor hsaC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003786|Rv3567c|hsaB
MSAQIDPRTFRSVLGQFCTGITVITTVHDDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEKQKDVSARFGSKEPDKFAGIDWRPSELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPAVKPRPLLFYRGDYTGIEPEKTTPAHWRDDLEAFLTTTTQDTWL