hsaB Family assigned · medium auto-curated
H37Rv Rv3567c · MTBC0 mtbc0_003786 ·
187 aa ·
4032396–4032959 MTBC0
(-) ·
RefSeq NP_218084.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | flavin-dependent monooxygenase reductase subunit HsaB |
|---|---|
| MTBC0 PGAP re-annotation | flavin-dependent monooxygenase reductase subunit HsaB |
| Revised (this work) | Flavin-dependent monooxygenase reductase subunit HsaB. Pfam: Flavin_Reduct (PF01613.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Analysis of genetic characteristics associated with reduced bedaquiline susceptibility in multidrug-resistant Mycobacterium tuberculosis. doi:10.1016/j.tube.2024.102572 | 2024 |
| Single molecule observation of hard-soft-acid-base (HSAB) interaction in engineered Mycobacterium smegmatis porin A (MspA) nanopores. doi:10.1039/c9sc05260g | 2019 |
| Comparative analysis of genes encoding key steroid core oxidation enzymes in fast-growing Mycobacterium spp. strains. doi:10.1016/j.jsbmb.2013.02.016 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Rv0681 (Rv0681).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.72 (95% CI -2.69 to 5.73). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in cellular metabolism. Predicted to be involved in lipid catabolism. |
|---|---|
| Mycobrowser EC |
1.-.-.-
· superseded EC numbering; the atlas uses the current class (1.5.1.36)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3598c
· 99.5% identity |
|---|---|
| M. marinum |
MMAR_5062
· 92.3% identity |
| M. smegmatis |
MSMEG_6035
· 81.4% identity |
| M. orygis |
RJtmp_003675
· 99.5% identity |
| M. abscessus |
MAB_0586
· 77.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WND9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Flavin-dependent monooxygenase, reductase subunit HsaB |
| EC (curated) |
EC 1.5.1.36
|
| Curated function | Catalyzes the reduction of free flavins (FMN or FAD) by NADH. Subsequently, the reduced flavins diffuse to the HsaA oxygenase subunit. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | hsaB |
| eggNOG description | COG1853 Conserved protein domain typically associated with flavoprotein oxygenases, DIM6 NTAB family |
| Orthologous group | COG1853 |
| KEGG orthology |
K16048
|
| KEGG pathways |
map00984, map01100
|
| Gene Ontology (46) |
GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0006066, GO:0006629, GO:0006694, GO:0006706, GO:0006707, GO:0008150, GO:0008152, GO:0008202 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.222 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 88.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 57.6% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 63.375. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -5.89 | 0.013 | required |
| fitness in mouse infection (in vivo) | +2.84 | 0.012 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 4.79 ppm · rank 2954/3519 (16.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 187 aa |
|---|---|
| Molecular weight | 20.5 kDa |
| Theoretical pI | 4.92 |
| GRAVY | -0.04 (hydrophilic) |
| Aliphatic index | 81.8 |
| Aromaticity | 0.102 |
| Instability index | 48.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Flavin_Reduct | PF01613.25 | 5.8e-47 | 15–160 | Flavin reductase like domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3nfw-assembly1_A |
1.00 | 0.99 | 5.3e-31 sig | 3nfw-assembly1_A Crystal structure of nitrilotriacetate monooxygenase component B (A0R521 homolog) from Mycobacterium thermoresistibile |
8ct0-assembly4_D |
1.00 | 0.93 | 2.8e-19 sig | 8ct0-assembly4_D Crystal structure of FAD reductase CtcQ from Kitasatospora aureofaciens in complex with FAD and NAD |
8ct0-assembly4_E |
1.00 | 0.92 | 9.3e-19 sig | 8ct0-assembly4_E Crystal structure of FAD reductase CtcQ from Kitasatospora aureofaciens in complex with FAD and NAD |
3rh7-assembly2_D |
1.00 | 0.93 | 7.8e-19 sig | 3rh7-assembly2_D Crystal structure of a putative oxidoreductase (SMa0793) from Sinorhizobium meliloti 1021 at 3.00 A resolution |
8ct0-assembly2_B |
1.00 | 0.93 | 2.8e-18 sig | 8ct0-assembly2_B Crystal structure of FAD reductase CtcQ from Kitasatospora aureofaciens in complex with FAD and NAD |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv3566A (- strand, 285 bp gap) |
|---|---|
| Downstream (3' on genome) | hsaC (- strand, 14 bp gap) |
| Predicted operon |
hsaB · hsaC · hsaD · hsaA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
mmpR5 (represses) · Rv1353c (activates) · Rv1985c (represses) · kstR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hsaC (extradiol dioxygenase), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3568c hsaC exp |
extradiol dioxygenase | 999 | 998 ctx | neighborhood:869 coexpression:838 database:900 textmining:913 |
Rv3570c hsaA exp |
flavin-dependent monooxygenase oxygenase subunit HsaA | 999 | 992 ctx | neighborhood:858 database:900 textmining:915 |
Rv3569c hsaD |
4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase | 995 | 963 ctx | neighborhood:869 coexpression:731 textmining:870 |
Rv3566A hyp |
hypothetical protein | 826 | 826 ctx | neighborhood:412 coexpression:716 |
Rv3571 kshB |
3-ketosteroid-9-alpha-hydroxylase reductase subunit | 927 | 795 ctx | neighborhood:758 textmining:662 |
Rv3572 hyp |
hypothetical protein | 749 | 748 ctx | neighborhood:745 |
Rv3566c nat |
arylamine N-acetyltransferase | 713 | 607 ctx | neighborhood:419 |
Rv3192 hyp |
hypothetical protein | 401 | 377 | |
Rv3518c cyp142 |
cytochrome P450 monooxygenase Cyp142 | 558 | 370 | |
Rv3526 kshA |
3-ketosteroid-9-alpha-monooxygenase oxygenase subunit | 569 | 252 | textmining:448 |
Rv3537 kstD |
3-oxosteroid 1-dehydrogenase | 774 | 234 | textmining:718 |
Rv3573c fadE34 |
acyl-CoA dehydrogenase FadE34 | 448 | 191 | |
Rv3534c hsaF |
4-hydroxy-2-oxovalerate aldolase | 687 | 88 | textmining:671 |
Rv3536c hsaE |
hydratase | 688 | 86 | textmining:674 |
Rv3564 fadE33 |
acyl-CoA dehydrogenase FadE33 | 457 | 85 | textmining:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: flavin-dependent monooxygenase reductase subunit HsaB
- MTBC0 PGAP product: flavin-dependent monooxygenase reductase subunit HsaB
- Pfam (hmmscan --cut_ga): Flavin_Reduct PF01613.25 (E=6e-47)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218084.1)
- Domains: Pfam-A via hmmscan --cut_ga — Flavin_Reduct (PF01613.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1853 - Curated reference: UniProt P9WND9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
hsaC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003786|Rv3567c|hsaB MSAQIDPRTFRSVLGQFCTGITVITTVHDDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEKQKDVSARFGSKEPDKFAGIDWRPSELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPAVKPRPLLFYRGDYTGIEPEKTTPAHWRDDLEAFLTTTTQDTWL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hsaB? Email the maintainer — the message is pre-filled with this gene's details.