hsaB Family assigned · medium auto-curated
H37Rv Rv3567c · MTBC0 mtbc0_003786 ·
187 aa · 4032396–4032959 (-) ·
RefSeq NP_218084.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | flavin-dependent monooxygenase reductase subunit HsaB |
|---|---|
| MTBC0 PGAP re-annotation | flavin-dependent monooxygenase reductase subunit HsaB |
| Revised (this work) | Flavin-dependent monooxygenase reductase subunit HsaB. Pfam: Flavin_Reduct (PF01613.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WND9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Flavin-dependent monooxygenase, reductase subunit HsaB |
| EC (curated) |
EC 1.5.1.36
|
| Curated function | Catalyzes the reduction of free flavins (FMN or FAD) by NADH. Subsequently, the reduced flavins diffuse to the HsaA oxygenase subunit. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | hsaB |
| eggNOG description | COG1853 Conserved protein domain typically associated with flavoprotein oxygenases, DIM6 NTAB family |
| Orthologous group | COG1853 |
| KEGG orthology |
K16048
|
| KEGG pathways |
map00984, map01100
|
| Gene Ontology (46) |
GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0006066, GO:0006629, GO:0006694, GO:0006706, GO:0006707, GO:0008150, GO:0008152, GO:0008202 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.222 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Flavin_Reduct | PF01613.25 | 5.8e-47 | 15–160 | Flavin reductase like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hsaC (extradiol dioxygenase), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3568c hsaC |
extradiol dioxygenase | 999 | 998 ctx | neighborhood:869 coexpression:838 database:900 textmining:913 |
Rv3570c hsaA |
flavin-dependent monooxygenase oxygenase subunit HsaA | 999 | 992 ctx | neighborhood:858 database:900 textmining:915 |
Rv3569c hsaD |
4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase | 995 | 963 ctx | neighborhood:869 coexpression:731 textmining:870 |
Rv3566A hyp |
hypothetical protein | 826 | 826 ctx | neighborhood:412 coexpression:716 |
Rv3571 kshB |
3-ketosteroid-9-alpha-hydroxylase reductase subunit | 927 | 795 ctx | neighborhood:758 textmining:662 |
Rv3572 hyp |
hypothetical protein | 749 | 748 ctx | neighborhood:745 |
Rv3566c nat |
arylamine N-acetyltransferase | 713 | 607 ctx | neighborhood:419 |
Rv3192 hyp |
hypothetical protein | 401 | 377 | |
Rv3518c cyp142 |
cytochrome P450 monooxygenase Cyp142 | 558 | 370 | |
Rv3526 kshA |
3-ketosteroid-9-alpha-monooxygenase oxygenase subunit | 569 | 252 | textmining:448 |
Rv3537 kstD |
3-oxosteroid 1-dehydrogenase | 774 | 234 | textmining:718 |
Rv3573c fadE34 |
acyl-CoA dehydrogenase FadE34 | 448 | 191 | |
Rv3534c hsaF |
4-hydroxy-2-oxovalerate aldolase | 687 | 88 | textmining:671 |
Rv3536c hsaE |
hydratase | 688 | 86 | textmining:674 |
Rv3564 fadE33 |
acyl-CoA dehydrogenase FadE33 | 457 | 85 | textmining:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: flavin-dependent monooxygenase reductase subunit HsaB
- MTBC0 PGAP product: flavin-dependent monooxygenase reductase subunit HsaB
- Pfam (hmmscan --cut_ga): Flavin_Reduct PF01613.25 (E=6e-47)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218084.1)
- Domains: Pfam-A via hmmscan --cut_ga — Flavin_Reduct (PF01613.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1853 - Curated reference: UniProt P9WND9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
hsaC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003786|Rv3567c|hsaB MSAQIDPRTFRSVLGQFCTGITVITTVHDDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEKQKDVSARFGSKEPDKFAGIDWRPSELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPAVKPRPLLFYRGDYTGIEPEKTTPAHWRDDLEAFLTTTTQDTWL