chsH1 Family assigned · low auto-curated
H37Rv Rv3541c · MTBC0 mtbc0_003758 ·
129 aa · 4004336–4004725 (-) ·
RefSeq NP_218058.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | 3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1 |
| Revised (this work) | 3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XHI0
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 3-oxo-4,17-pregnadiene-20-carboxyl-CoA hydratase beta subunit |
| EC (curated) |
EC 4.2.1.-
|
| Curated function | Involved in cholesterol side chain degradation. Catalyzes the hydration of 3-oxo-4,17-pregnadiene-20-carboxyl-CoA (3-OPDC-CoA) to form 17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA (17-HOPC-CoA), in the modified beta-oxidation pathway for cholesterol side chain degradation. Can also use octenoyl-CoA and decenoyl-CoA, with lower efficiency. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | dehydratase |
| Orthologous group | COG2030 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ltp2 (lipid transfer protein), high confidence from genomic context alone (score 998 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3542c chsH2 hyp |
hypothetical protein | 999 | 1000 ctx | neighborhood:882 fusion:798 cooccurence:774 coexpression:826 experimental:999 database:900 |
Rv3540c ltp2 |
lipid transfer protein | 999 | 998 ctx | neighborhood:882 cooccurence:730 coexpression:857 database:500 textmining:809 |
Rv3543c fadE29 |
acyl-CoA dehydrogenase FadE29 | 999 | 994 ctx | neighborhood:881 cooccurence:757 database:639 textmining:857 |
Rv3544c fadE28 |
acyl-CoA dehydrogenase FadE28 | 997 | 989 ctx | neighborhood:881 cooccurence:674 database:639 textmining:810 |
Rv3545c cyp125 |
steroid C26-monooxygenase | 968 | 907 ctx | neighborhood:863 textmining:672 |
Rv3546 fadA5 |
acetyl-CoA acetyltransferase FadA | 920 | 888 ctx | neighborhood:778 |
Rv3504 fadE26 |
acyl-CoA dehydrogenase FadE26 | 876 | 872 ctx | cooccurence:755 |
Rv3573c fadE34 |
acyl-CoA dehydrogenase FadE34 | 868 | 864 ctx | cooccurence:741 |
Rv3522 ltp4 |
lipid transfer protein | 885 | 860 ctx | cooccurence:773 |
Rv3562 fadE31 |
acyl-CoA dehydrogenase FadE31 | 853 | 849 ctx | cooccurence:713 |
Rv3550 echA20 |
enoyl-CoA hydratase EchA20 | 854 | 848 ctx | cooccurence:721 |
Rv3521 hyp |
hypothetical protein | 874 | 843 ctx | cooccurence:774 |
Rv3523 ltp3 |
lipid carrier protein | 871 | 842 ctx | cooccurence:747 |
Rv3570c hsaA |
flavin-dependent monooxygenase oxygenase subunit HsaA | 842 | 837 ctx | cooccurence:690 |
Rv3560c fadE30 |
acyl-CoA dehydrogenase FadE30 | 850 | 826 ctx | cooccurence:670 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: 3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218058.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2030 - Curated reference: UniProt I6XHI0 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
148 functional partner(s); context anchor
ltp2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003758|Rv3541c|chsH1 MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS