chsH1 Family assigned · low auto-curated

H37Rv Rv3541c · MTBC0 mtbc0_003758 · 129 aa · 4004336–4004725 (-) · RefSeq NP_218058.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1
Revised (this work)3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XHI0 SwissProt · reviewed · Evidence at protein level
UniProt name3-oxo-4,17-pregnadiene-20-carboxyl-CoA hydratase beta subunit
EC (curated) EC 4.2.1.-
Curated functionInvolved in cholesterol side chain degradation. Catalyzes the hydration of 3-oxo-4,17-pregnadiene-20-carboxyl-CoA (3-OPDC-CoA) to form 17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA (17-HOPC-CoA), in the modified beta-oxidation pathway for cholesterol side chain degradation. Can also use octenoyl-CoA and decenoyl-CoA, with lower efficiency.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptiondehydratase
Orthologous groupCOG2030

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ltp2 (lipid transfer protein), high confidence from genomic context alone (score 998 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3542c chsH2 hyp hypothetical protein 999 1000 ctx neighborhood:882 fusion:798 cooccurence:774 coexpression:826 experimental:999 database:900
Rv3540c ltp2 lipid transfer protein 999 998 ctx neighborhood:882 cooccurence:730 coexpression:857 database:500 textmining:809
Rv3543c fadE29 acyl-CoA dehydrogenase FadE29 999 994 ctx neighborhood:881 cooccurence:757 database:639 textmining:857
Rv3544c fadE28 acyl-CoA dehydrogenase FadE28 997 989 ctx neighborhood:881 cooccurence:674 database:639 textmining:810
Rv3545c cyp125 steroid C26-monooxygenase 968 907 ctx neighborhood:863 textmining:672
Rv3546 fadA5 acetyl-CoA acetyltransferase FadA 920 888 ctx neighborhood:778
Rv3504 fadE26 acyl-CoA dehydrogenase FadE26 876 872 ctx cooccurence:755
Rv3573c fadE34 acyl-CoA dehydrogenase FadE34 868 864 ctx cooccurence:741
Rv3522 ltp4 lipid transfer protein 885 860 ctx cooccurence:773
Rv3562 fadE31 acyl-CoA dehydrogenase FadE31 853 849 ctx cooccurence:713
Rv3550 echA20 enoyl-CoA hydratase EchA20 854 848 ctx cooccurence:721
Rv3521 hyp hypothetical protein 874 843 ctx cooccurence:774
Rv3523 ltp3 lipid carrier protein 871 842 ctx cooccurence:747
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 842 837 ctx cooccurence:690
Rv3560c fadE30 acyl-CoA dehydrogenase FadE30 850 826 ctx cooccurence:670

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: 3-oxo-23%2C24-bisnorchol-4%2C17(20)-dien-22-oyl-CoA hydratase subunit beta ChsH1
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218058.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2030
  • Curated reference: UniProt I6XHI0 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 148 functional partner(s); context anchor ltp2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003758|Rv3541c|chsH1
MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS