echA20 Family assigned · medium auto-curated

H37Rv Rv3550 · MTBC0 mtbc0_003767 · 247 aa · 4012830–4013573 (+) · RefSeq NP_218067.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)enoyl-CoA hydratase EchA20
MTBC0 PGAP re-annotationenoyl-CoA hydratase family protein
Revised (this work)Enoyl-CoA hydratase family protein. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y3U6 SwissProt · reviewed · Evidence at protein level
UniProt name(7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase
EC (curated) EC 4.1.99.-
Curated functionInvolved in the final steps of cholesterol and steroid degradation. Catalyzes the hydrolytic ring D opening of (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA (HIEC-CoA) to (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA (COCHEA-CoA) (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameechA20
eggNOG descriptionEnoyl-CoA hydratase
Orthologous groupCOG1024
EC number EC 4.2.1.17
KEGG orthology K01692
KEGG pathways map00071, map00280, map00281, map00310, map00360, map00362, map00380, map00410, map00627, map00640, map00650, map00903, map00930, map01100, map01110, map01120, map01130, map01212
KEGG modules M00032, M00087

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.351 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ECH_1PF00378.26 1.3e-3610–209 Enoyl-CoA hydratase/isomerase
ECH_2PF16113.11 3.0e-2022–198 Enoyl-CoA hydratase/isomerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3551 (CoA-transferase subunit alpha), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3551 CoA-transferase subunit alpha 999 998 ctx neighborhood:882 cooccurence:746 coexpression:869 database:500 textmining:634
Rv3552 CoA-transferase subunit beta 999 998 ctx neighborhood:882 cooccurence:749 coexpression:869 database:500 textmining:564
Rv3549c short-chain type dehydrogenase/reductase 995 985 ctx neighborhood:787 cooccurence:422 coexpression:849 textmining:698
Rv3553 oxidoreductase 988 979 ctx neighborhood:773 coexpression:864 textmining:472
Rv3548c short-chain type dehydrogenase/reductase 983 968 ctx neighborhood:716 coexpression:785 textmining:498
Rv3560c fadE30 acyl-CoA dehydrogenase FadE30 993 938 ctx cooccurence:497 coexpression:811 textmining:896
Rv3522 ltp4 lipid transfer protein 928 909 ctx cooccurence:649 database:447
Rv3559c oxidoreductase 942 894 ctx cooccurence:561 database:591 textmining:478
Rv3562 fadE31 acyl-CoA dehydrogenase FadE31 962 892 ctx cooccurence:641 coexpression:538 textmining:667
Rv3561 fadD3 fatty-acid--CoA ligase FadD3 977 883 coexpression:841 textmining:818
Rv3523 ltp3 lipid carrier protein 913 879 ctx cooccurence:536 database:447
Rv3540c ltp2 lipid transfer protein 907 877 ctx cooccurence:526 database:447
Rv3541c chsH1 hyp hypothetical protein 854 848 ctx cooccurence:721
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 851 845 database:750
Rv2500c fadE19 acyl-CoA dehydrogenase FadE19 850 845 database:750

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: enoyl-CoA hydratase EchA20
  • MTBC0 PGAP product: enoyl-CoA hydratase family protein
  • Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=1e-36), ECH_2 PF16113.11 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218067.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1024
  • Curated reference: UniProt I6Y3U6 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 166 functional partner(s); context anchor Rv3551
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003767|Rv3550|echA20
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNAGVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIVASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRDQLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHRDAFVKKS